| Clone Name | rbaet112c01 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | UVRA_PSELE (P52087) UvrABC system protein A (UvrA protein) (Exci... | 29 | 7.8 | 2 | PRR3_MOUSE (Q811B5) Proline-rich protein 3 (MHC class I region p... | 29 | 7.8 |
|---|
>UVRA_PSELE (P52087) UvrABC system protein A (UvrA protein) (Excinuclease ABC| subunit A) (Fragment) Length = 689 Score = 28.9 bits (63), Expect = 7.8 Identities = 22/63 (34%), Positives = 30/63 (47%), Gaps = 9/63 (14%) Frame = +1 Query: 274 GLHPRDEAKTSLASSHQLKQFCSPLHQVSICLLFVQHAAW----GEQIDQRDG-----GP 426 GLHP D + LA+ +LKQ + L V L ++HA W G + + G GP Sbjct: 416 GLHPAD-TQALLAALDRLKQAGNSLFVVEHALGVIRHADWIVDVGPEAGEHGGRILYSGP 474 Query: 427 PCG 435 P G Sbjct: 475 PQG 477
>PRR3_MOUSE (Q811B5) Proline-rich protein 3 (MHC class I region proline-rich| protein CAT56) Length = 190 Score = 28.9 bits (63), Expect = 7.8 Identities = 18/49 (36%), Positives = 24/49 (48%) Frame = +1 Query: 343 PLHQVSICLLFVQHAAWGEQIDQRDGGPPCGQLHAPPSAEGRPAAGRSA 489 PL Q L + G++ D+R GPP L PP A G+P +SA Sbjct: 12 PLPQQQQHLALSERDEPGDEEDERPMGPP-SLLGPPPMANGKPGDPKSA 59 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 75,226,262 Number of Sequences: 219361 Number of extensions: 1591635 Number of successful extensions: 4160 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3920 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4156 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3478785780 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)