| Clone Name | rbaet10g02 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | ALG10_CANAL (Q59YV2) Alpha-1,2 glucosyltransferase ALG10 (EC 2.4... | 30 | 2.2 | 2 | CND1_YEAST (Q06156) Condensin complex subunit 1 (XCAP-D2 homolog) | 28 | 8.5 |
|---|
>ALG10_CANAL (Q59YV2) Alpha-1,2 glucosyltransferase ALG10 (EC 2.4.1.-)| (Alpha-2-glucosyltransferase ALG10) (Dolichyl-phosphoglucose-dependent glucosyltransferase ALG10) (Asparagine-linked glycosylation protein 10) Length = 450 Score = 29.6 bits (65), Expect = 2.2 Identities = 12/37 (32%), Positives = 20/37 (54%) Frame = -3 Query: 125 DSHRWSFHFVLLLYCVTNQAWSWFP*WLHGNNIKIFF 15 D+H+ H V + YC T + P WL+ + IK ++ Sbjct: 269 DNHQIELHIVQVFYCFTFITFFTIPNWLNKSTIKKYY 305
>CND1_YEAST (Q06156) Condensin complex subunit 1 (XCAP-D2 homolog)| Length = 1176 Score = 27.7 bits (60), Expect = 8.5 Identities = 17/48 (35%), Positives = 24/48 (50%), Gaps = 1/48 (2%) Frame = -2 Query: 204 RCNEQPPQVRTDACSGCN-ICSLKSRVGFTPVVFPFRATLVLCNKSSV 64 R + P VRT A GC+ IC L S+ + F A L ++SS+ Sbjct: 366 RFQDSNPYVRTKAIQGCSKICDLSSKFNKSKAKFTSLAVRSLQDRSSL 413 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 29,033,573 Number of Sequences: 219361 Number of extensions: 428868 Number of successful extensions: 1269 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1257 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1269 length of database: 80,573,946 effective HSP length: 47 effective length of database: 70,263,979 effective search space used: 1686335496 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)