| Clone Name | rbaet10g01 |
|---|---|
| Clone Library Name | barley_pub |
>MTR_NEUCR (P38680) N amino acid transport system protein (Methyltryptophan| resistance protein) Length = 470 Score = 35.8 bits (81), Expect = 0.060 Identities = 17/52 (32%), Positives = 32/52 (61%), Gaps = 2/52 (3%) Frame = -2 Query: 425 IVSTVLAISLPFFNDILGLLGALGFWPLTVYFPVEMY--ISQSKMKKYSRKW 276 +++ V+A ++PFF+D+L + AL + YFP MY I+++ K +K+ Sbjct: 372 LIAWVIAEAIPFFSDLLAICSALFISGFSFYFPALMYFKITRNDAKSQGKKY 423
>UNC47_CAEEL (P34579) Vesicular GABA transporter (Uncoordinated protein 47)| (Protein unc-47) Length = 486 Score = 30.4 bits (67), Expect = 2.5 Identities = 14/66 (21%), Positives = 36/66 (54%), Gaps = 2/66 (3%) Frame = -2 Query: 467 SLNMFRLVWRTAFVIVSTVLAISLPFFNDILGLLGALGFWPLTVYFPV--EMYISQSKMK 294 SL + + R V+ + +A+S+P+ +++GL+G + L+ +P +YI + + Sbjct: 389 SLREWAVTLRIILVLFTLFVALSVPYLVELMGLVGNITGTMLSFIWPALFHLYIKEKTLN 448 Query: 293 KYSRKW 276 + +++ Sbjct: 449 NFEKRF 454
>S36A1_MOUSE (Q8K4D3) Proton-coupled amino acid transporter 1 (Proton/amino acid| transporter 1) (Solute carrier family 36 member 1) Length = 475 Score = 28.9 bits (63), Expect = 7.3 Identities = 16/44 (36%), Positives = 25/44 (56%) Frame = -2 Query: 458 MFRLVWRTAFVIVSTVLAISLPFFNDILGLLGALGFWPLTVYFP 327 M L RTA V V+ VLAI +P + ++ L+G++ L + P Sbjct: 372 MVDLCVRTAMVCVTCVLAILIPRLDLVISLVGSVSSSALALIIP 415
>VIAAT_HUMAN (Q9H598) Vesicular inhibitory amino acid transporter (GABA and| glycine transporter) (Vesicular GABA transporter) (hVIAAT) (Solute carrier family 32 member 1) Length = 525 Score = 28.9 bits (63), Expect = 7.3 Identities = 15/41 (36%), Positives = 24/41 (58%) Frame = -2 Query: 479 SGTFSLNMFRLVWRTAFVIVSTVLAISLPFFNDILGLLGAL 357 SG L + L R A V+ + ++AI +P F ++GL G+L Sbjct: 423 SGDGRLKSWGLTLRCALVVFTLLMAIYVPHFALLMGLTGSL 463
>MRAY_CHRVO (Q7NPZ6) Phospho-N-acetylmuramoyl-pentapeptide-transferase (EC| 2.7.8.13) (UDP-MurNAc-pentapeptide phosphotransferase) Length = 361 Score = 28.5 bits (62), Expect = 9.6 Identities = 16/52 (30%), Positives = 26/52 (50%), Gaps = 11/52 (21%) Frame = -2 Query: 455 FRLVWRTAFVIVSTVLAIS-----------LPFFNDILGLLGALGFWPLTVY 333 F++ W++A I + V I+ +PFF + LGA+GF LT + Sbjct: 132 FKMAWQSAIAIGAGVFLIATAKLPASTELIVPFFKTVAYPLGAVGFCVLTYF 183
>LIAF_BACSU (O32199) Protein liaF| Length = 241 Score = 28.5 bits (62), Expect = 9.6 Identities = 17/47 (36%), Positives = 25/47 (53%) Frame = -2 Query: 413 VLAISLPFFNDILGLLGALGFWPLTVYFPVEMYISQSKMKKYSRKWV 273 + + F I+G+ G L FWPL +F + Y +KKYSR W+ Sbjct: 11 IALFGISMFLQIIGI-GDLLFWPL--FFLIAGYF----LKKYSRDWL 50 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 51,565,621 Number of Sequences: 219361 Number of extensions: 801261 Number of successful extensions: 2347 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 2283 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2344 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3246866728 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)