| Clone Name | rbaet10f09 |
|---|---|
| Clone Library Name | barley_pub |
>CRD1_HORVU (Q5EFU4) Magnesium-protoporphyrin IX monomethyl ester [oxidative]| cyclase, chloroplast precursor (EC 1.14.13.81) (Mg-protoporphyrin IX monomethyl ester oxidative cyclase) (Protein Xantha-l) Length = 417 Score = 66.2 bits (160), Expect = 2e-11 Identities = 33/34 (97%), Positives = 33/34 (97%) Frame = -2 Query: 327 LIAQLVSEIIDAYLMPPIESGSVDFAEFEPKLVY 226 LIAQLVSEII AYLMPPIESGSVDFAEFEPKLVY Sbjct: 384 LIAQLVSEIIAAYLMPPIESGSVDFAEFEPKLVY 417
>CRD1_EUPES (Q945B7) Magnesium-protoporphyrin IX monomethyl ester [oxidative]| cyclase, chloroplast precursor (EC 1.14.13.81) (Mg-protoporphyrin IX monomethyl ester oxidative cyclase) Length = 405 Score = 63.2 bits (152), Expect = 2e-10 Identities = 31/34 (91%), Positives = 32/34 (94%) Frame = -2 Query: 327 LIAQLVSEIIDAYLMPPIESGSVDFAEFEPKLVY 226 LIA LVSEI+ AYLMPPIESGSVDFAEFEPKLVY Sbjct: 372 LIAALVSEILAAYLMPPIESGSVDFAEFEPKLVY 405
>CRD1_ARATH (Q9M591) Magnesium-protoporphyrin IX monomethyl ester [oxidative]| cyclase, chloroplast precursor (EC 1.14.13.81) (Mg-protoporphyrin IX monomethyl ester oxidative cyclase) (Copper response defect 1 protein) (Dicarboxylate diiron protein) (AtZIP Length = 409 Score = 57.8 bits (138), Expect = 7e-09 Identities = 26/34 (76%), Positives = 29/34 (85%) Frame = -2 Query: 327 LIAQLVSEIIDAYLMPPIESGSVDFAEFEPKLVY 226 L+ L SEI+ AYLMPP+ESGSVDFAEFEP LVY Sbjct: 376 LVTSLASEILAAYLMPPVESGSVDFAEFEPNLVY 409
>CRD1_GOSHI (Q6SJV8) Magnesium-protoporphyrin IX monomethyl ester [oxidative]| cyclase, chloroplast precursor (EC 1.14.13.81) (Mg-protoporphyrin IX monomethyl ester oxidative cyclase) Length = 405 Score = 57.8 bits (138), Expect = 7e-09 Identities = 27/34 (79%), Positives = 30/34 (88%) Frame = -2 Query: 327 LIAQLVSEIIDAYLMPPIESGSVDFAEFEPKLVY 226 LIA L SE++ YLMPPIESGSVDFAEFEP+LVY Sbjct: 372 LIAALASELLATYLMPPIESGSVDFAEFEPQLVY 405
>CTH1_CHLRE (Q9AR22) Magnesium-protoporphyrin IX monomethyl ester [oxidative]| cyclase 2, chloroplast precursor (EC 1.14.13.81) (Mg-protoporphyrin IX monomethyl ester oxidative cyclase 2) (Copper target homolog 1 protein) Length = 407 Score = 29.3 bits (64), Expect = 2.6 Identities = 12/34 (35%), Positives = 21/34 (61%) Frame = -2 Query: 327 LIAQLVSEIIDAYLMPPIESGSVDFAEFEPKLVY 226 ++ ++V+E+ ++M P ESGS D + LVY Sbjct: 374 ILERMVAEVFQVFIMTPKESGSYDLDANKTALVY 407
>LTBP3_MOUSE (Q61810) Latent transforming growth factor beta-binding protein 3| precursor (LTBP-3) Length = 1268 Score = 28.5 bits (62), Expect = 4.4 Identities = 13/43 (30%), Positives = 21/43 (48%) Frame = -1 Query: 220 LSKKDSSLPIFTNIMMHHAPRESLNEHRVHG*LT*STSSCAHL 92 +S + + P N+ +HH P S+ HR+ G +S HL Sbjct: 214 ISAEVQAPPPVVNVRVHHPPEASVQVHRIEGPNAEGPASSQHL 256
>SYR_CLOPE (Q8XJU2) Arginyl-tRNA synthetase (EC 6.1.1.19) (Arginine--tRNA| ligase) (ArgRS) Length = 565 Score = 27.3 bits (59), Expect = 9.8 Identities = 11/33 (33%), Positives = 18/33 (54%) Frame = +1 Query: 205 NPFSTNSVDKLGLKFGKINGARLDWGHEVRIDD 303 NP N + G +FGK+ A WG+E +++ Sbjct: 150 NPIRINHLGDWGTQFGKLISAYKRWGNEEALEE 182 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 45,275,518 Number of Sequences: 219361 Number of extensions: 778767 Number of successful extensions: 1442 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 1427 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1442 length of database: 80,573,946 effective HSP length: 84 effective length of database: 62,147,622 effective search space used: 1491542928 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)