| Clone Name | rbaet10e12 |
|---|---|
| Clone Library Name | barley_pub |
>CT059_HUMAN (Q9BYT1) Putative transporter C20orf59| Length = 436 Score = 30.4 bits (67), Expect = 1.1 Identities = 10/23 (43%), Positives = 14/23 (60%) Frame = -1 Query: 261 WSCIQYFQIGSGICWIWHVYCYI 193 W I YF G + W+W+VY Y+ Sbjct: 183 WQSIFYFSGGLTLLWVWYVYRYL 205
>TPSD3_ABIGR (O24475) Pinene synthase, chloroplast precursor (EC 4.2.3.14)| (Beta-geraniolene synthase) ((-)-(1S,5S)-pinene synthase) (Agg-pin1) Length = 628 Score = 28.5 bits (62), Expect = 4.1 Identities = 18/61 (29%), Positives = 28/61 (45%) Frame = +1 Query: 127 VFGNKMYNGKAYHRTSKMLELVNITVNMPNPADTTSYLKVLNTRPQVLVLRWDALQLFPE 306 VFG N K+Y ++ K+LEL + N+ + L R ++RW FPE Sbjct: 287 VFGQDTENTKSYVKSKKLLELAKLEFNI---------FQSLQKRELESLVRWWKESGFPE 337 Query: 307 L 309 + Sbjct: 338 M 338
>RNC_LACAC (Q5FJJ7) Ribonuclease III (EC 3.1.26.3) (RNase III)| Length = 228 Score = 28.5 bits (62), Expect = 4.1 Identities = 16/41 (39%), Positives = 20/41 (48%) Frame = +1 Query: 25 AFLHSRNKKVQPVDGLRFYNRYHFLDIGNIVL*TVFGNKMY 147 AF HS P DG+R Y + FL G+ VL N +Y Sbjct: 27 AFTHSSYSNEHPDDGIRDYEKLEFL--GDAVLELAVSNYLY 65
>NH199_CAEEL (O17934) Nuclear hormone receptor family member nhr-199| Length = 405 Score = 28.5 bits (62), Expect = 4.1 Identities = 16/34 (47%), Positives = 21/34 (61%), Gaps = 3/34 (8%) Frame = -2 Query: 218 GFGMFTVIFTN--SSILLVLWYAFPLY-ILLPNT 126 GF ++F N +SI LW AFP Y +LLP+T Sbjct: 161 GFNELPIVFQNESTSIYQFLWEAFPEYSMLLPDT 194
>YAR2_SCHPO (Q10135) DNA-binding protein C23E2.02 in chromosome I| Length = 1273 Score = 28.1 bits (61), Expect = 5.4 Identities = 15/54 (27%), Positives = 23/54 (42%), Gaps = 9/54 (16%) Frame = -1 Query: 246 YFQIGSGICWIWHVYCYIYQLEHFACSVVCLS---------VIHFITKYGS*NY 112 YFQI + ICW+W + + + VC+ F+ +YG NY Sbjct: 429 YFQIRNSICWLW-IKNPTHAISRVEAQGVCVDRCLFQLASLAYEFLVRYGYINY 481
>RTCA_METAC (Q8TH85) Probable RNA 3'-terminal phosphate cyclase (EC 6.5.1.4)| (RNA-3'-phosphate cyclase) (RNA cyclase) Length = 355 Score = 27.7 bits (60), Expect = 7.0 Identities = 14/41 (34%), Positives = 20/41 (48%) Frame = +1 Query: 169 TSKMLELVNITVNMPNPADTTSYLKVLNTRPQVLVLRWDAL 291 T K +++ NI N PNP +LK L T ++ R L Sbjct: 26 TGKDVKVTNIRKNRPNPGLKQQHLKALETAARICEARVSGL 66
>DEGP_BUCBP (Q89AP5) Probable serine protease do-like precursor (EC 3.4.21.-)| Length = 465 Score = 27.7 bits (60), Expect = 7.0 Identities = 15/47 (31%), Positives = 24/47 (51%) Frame = +1 Query: 136 NKMYNGKAYHRTSKMLELVNITVNMPNPADTTSYLKVLNTRPQVLVL 276 N + NG +RT + VN + +++ KVL T+P +LVL Sbjct: 405 NYVNNGTPAYRTGLRKNDIIFEVNKYQVSSLSNFQKVLKTKPLILVL 451
>LSHR_CALJA (O02721) Lutropin-choriogonadotropic hormone receptor precursor| (LH/CG-R) (LSH-R) (Luteinizing hormone receptor) Length = 676 Score = 27.7 bits (60), Expect = 7.0 Identities = 16/36 (44%), Positives = 20/36 (55%) Frame = -2 Query: 266 TCGLVFSTFR*EVVSAGFGMFTVIFTNSSILLVLWY 159 TC S F +SA F M + TNS +LLVL+Y Sbjct: 557 TCMAPISFF---AISAAFKMPLITVTNSKVLLVLFY 589
>PTR9_CAEEL (Q03602) Patched-related protein 9| Length = 844 Score = 27.3 bits (59), Expect = 9.2 Identities = 15/55 (27%), Positives = 21/55 (38%), Gaps = 1/55 (1%) Frame = -3 Query: 184 RAFCLFCGMPFRYTFYYQIRFIK-LYCLCLESGIGCRTVIHQLAEPFCSVNAERP 23 R FC +C M + F +Q+ F + LC CR + FC P Sbjct: 394 RVFCTYCAMAILFMFLFQVTFFNAVMSLC------CRREVSGKHPVFCCYEITPP 442
>SEM11_ARATH (Q9XIR8) Probable 26 proteasome complex subunit sem1-1| Length = 74 Score = 27.3 bits (59), Expect = 9.2 Identities = 15/29 (51%), Positives = 16/29 (55%) Frame = -1 Query: 372 EAVQQWEXXXXXXXXXXDFSLQLRKELES 286 E QQWE DFS QLRKELE+ Sbjct: 41 EVSQQWEDDWDDDDVNDDFSRQLRKELEN 69
>CTGF_HUMAN (P29279) Connective tissue growth factor precursor (Hypertrophic| chondrocyte-specific protein 24) Length = 349 Score = 27.3 bits (59), Expect = 9.2 Identities = 15/51 (29%), Positives = 22/51 (43%) Frame = -3 Query: 175 CLFCGMPFRYTFYYQIRFIKLYCLCLESGIGCRTVIHQLAEPFCSVNAERP 23 C+F G +R +Q K C CL+ +GC P CS++ P Sbjct: 103 CIFGGTVYRSGESFQSS-CKYQCTCLDGAVGCM--------PLCSMDVRLP 144 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 45,995,510 Number of Sequences: 219361 Number of extensions: 805966 Number of successful extensions: 2027 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 1996 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2027 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 1402043640 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)