| Clone Name | rbaet10d11 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | TBX8_CAEEL (Q22292) T-box transcription factor tbx-8 | 28 | 5.3 | 2 | UL16_VZVD (P09293) Gene 44 protein | 28 | 6.9 |
|---|
>TBX8_CAEEL (Q22292) T-box transcription factor tbx-8| Length = 315 Score = 28.5 bits (62), Expect = 5.3 Identities = 14/44 (31%), Positives = 26/44 (59%), Gaps = 1/44 (2%) Frame = +1 Query: 4 RTEQDEAYTITHELSVSVIVTKSNRRIYHRLHFTL-SPTPVLIY 132 R +QD+ + + H +IVTKS R+++ +L + + TP +Y Sbjct: 10 REDQDKLWNLFHYHKNEMIVTKSGRKMFPKLEYVVRGLTPNKLY 53
>UL16_VZVD (P09293) Gene 44 protein| Length = 363 Score = 28.1 bits (61), Expect = 6.9 Identities = 12/29 (41%), Positives = 19/29 (65%) Frame = +3 Query: 66 KEQQKNLPPATFHLIPHTSTYLSYRTDAS 152 + +Q NLPP TFH+I + + +SY A+ Sbjct: 84 RPRQMNLPPKTFHVIVNFNYEVSYAMTAT 112 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 21,088,309 Number of Sequences: 219361 Number of extensions: 278031 Number of successful extensions: 1200 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 985 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1196 length of database: 80,573,946 effective HSP length: 26 effective length of database: 74,870,560 effective search space used: 1796893440 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)