| Clone Name | rbaet10b11 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | NHAC_BACSU (O07553) Na(+)/H(+) antiporter (Sodium/proton antipor... | 28 | 8.8 | 2 | ESAG8_TRYBB (P23799) Putative adenylate cyclase regulatory prote... | 28 | 8.8 |
|---|
>NHAC_BACSU (O07553) Na(+)/H(+) antiporter (Sodium/proton antiporter)| (Sodium/hydrogen antiporter) Length = 453 Score = 27.7 bits (60), Expect = 8.8 Identities = 11/31 (35%), Positives = 19/31 (61%) Frame = +1 Query: 85 TSTIRY*SYIQSTHILMRTLFKCLLAGHKVG 177 T T+ S+I+ +H+L+ LF C++ VG Sbjct: 95 TMTVYALSFIEPSHLLLTALFSCMIISTLVG 125
>ESAG8_TRYBB (P23799) Putative adenylate cyclase regulatory protein (Leucine| repeat protein) (VSG expression site-associated protein F14.9) Length = 630 Score = 27.7 bits (60), Expect = 8.8 Identities = 11/32 (34%), Positives = 19/32 (59%), Gaps = 2/32 (6%) Frame = -3 Query: 112 CMTNIGSLMLYPIKDVYN*GPIWNMK--CLFE 23 C+T + + L+ + N GPIWN++ C+ E Sbjct: 483 CLTGLEEMYLHGCRKCTNFGPIWNLRNVCVLE 514 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 26,941,201 Number of Sequences: 219361 Number of extensions: 405803 Number of successful extensions: 830 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 824 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 830 length of database: 80,573,946 effective HSP length: 35 effective length of database: 72,896,311 effective search space used: 1749511464 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)