| Clone Name | rbaet100g05 |
|---|---|
| Clone Library Name | barley_pub |
>CYSKP_SOLTU (O81155) Cysteine synthase, chloroplast precursor (EC 2.5.1.47)| (O-acetylserine sulfhydrylase) (O-acetylserine (Thiol)-lyase) (CSase B) (CS-B) (OAS-TL B) Length = 386 Score = 40.0 bits (92), Expect = 0.002 Identities = 18/22 (81%), Positives = 20/22 (90%) Frame = -1 Query: 424 ERYLSSVLFQSIREECVKMEAE 359 ERYLSS+LFQSIREEC KM+ E Sbjct: 364 ERYLSSILFQSIREECEKMKPE 385
>CYSKP_CAPAN (P31300) Cysteine synthase, chloroplast precursor (EC 2.5.1.47)| (O-acetylserine sulfhydrylase) (O-acetylserine (Thiol)-lyase) (CSase B) (CS-B) (OAS-TL B) Length = 374 Score = 40.0 bits (92), Expect = 0.002 Identities = 18/22 (81%), Positives = 20/22 (90%) Frame = -1 Query: 424 ERYLSSVLFQSIREECVKMEAE 359 ERYLSS+LFQSIREEC KM+ E Sbjct: 352 ERYLSSILFQSIREECEKMKPE 373
>CYSKP_SPIOL (P32260) Cysteine synthase, chloroplast precursor (EC 2.5.1.47)| (O-acetylserine sulfhydrylase) (O-acetylserine (Thiol)-lyase) (CSase B) (CS-B) (OAS-TL B) Length = 383 Score = 38.1 bits (87), Expect = 0.008 Identities = 17/22 (77%), Positives = 19/22 (86%) Frame = -1 Query: 424 ERYLSSVLFQSIREECVKMEAE 359 ERYLSS+LFQSIREEC M+ E Sbjct: 362 ERYLSSILFQSIREECENMKPE 383
>CYSKP_ARATH (P47999) Cysteine synthase, chloroplast precursor (EC 2.5.1.47)| (O-acetylserine sulfhydrylase) (O-acetylserine (Thiol)-lyase) (CSase B) (CS-B) (OAS-TL B) (AtCS-B) (cpACS1) (At.OAS.7-4) Length = 392 Score = 35.8 bits (81), Expect = 0.042 Identities = 16/22 (72%), Positives = 19/22 (86%) Frame = -1 Query: 424 ERYLSSVLFQSIREECVKMEAE 359 ERYLS+ LFQSIREEC +M+ E Sbjct: 370 ERYLSTQLFQSIREECEQMQPE 391
>CYSKM_ARATH (Q43725) Cysteine synthase, mitochondrial precursor (EC 2.5.1.47)| (O-acetylserine sulfhydrylase) (O-acetylserine (Thiol)-lyase) (CSase C) (CS-C) (OAS-TL C) (AtCS-C) Length = 430 Score = 33.5 bits (75), Expect = 0.21 Identities = 16/22 (72%), Positives = 18/22 (81%) Frame = -1 Query: 424 ERYLSSVLFQSIREECVKMEAE 359 ERYLS+ LFQSIREE KM+ E Sbjct: 408 ERYLSTPLFQSIREEVEKMQPE 429
>CYSK_MAIZE (P80608) Cysteine synthase (EC 2.5.1.47) (O-acetylserine| sulfhydrylase) (O-acetylserine (Thiol)-lyase) (CSase) (OAS-TL) Length = 325 Score = 31.6 bits (70), Expect = 0.79 Identities = 15/22 (68%), Positives = 17/22 (77%) Frame = -1 Query: 424 ERYLSSVLFQSIREECVKMEAE 359 ERYLSSVLFQSI++E M E Sbjct: 303 ERYLSSVLFQSIKKEAESMVVE 324
>CYSK1_ORYSA (Q9XEA6) Cysteine synthase (EC 2.5.1.47) (O-acetylserine| sulfhydrylase) (O-acetylserine (Thiol)-lyase) (CSase) (OAS-TL) Length = 321 Score = 31.6 bits (70), Expect = 0.79 Identities = 15/22 (68%), Positives = 17/22 (77%) Frame = -1 Query: 424 ERYLSSVLFQSIREECVKMEAE 359 ERYLSSVLFQSI++E M E Sbjct: 300 ERYLSSVLFQSIKKEAENMVVE 321
>NHAX_BACSU (O07552) Stress response protein nhaX| Length = 166 Score = 30.4 bits (67), Expect = 1.8 Identities = 20/49 (40%), Positives = 28/49 (57%), Gaps = 1/49 (2%) Frame = +3 Query: 264 FHARLILIRFDGEEDAAKKKASLPGAEMALHASASI-FTHSSLMDWNST 407 FHA I++ FDG E++ KKA L ++A +A+I HS M N T Sbjct: 2 FHADRIIVAFDGSENS--KKALLTAIDLAKTVNAAITVAHSHDMKDNQT 48
>CYSK_SPIOL (Q00834) Cysteine synthase (EC 2.5.1.47) (O-acetylserine| sulfhydrylase) (O-acetylserine (Thiol)-lyase) (CSase A) (OAS-TL A) Length = 325 Score = 30.4 bits (67), Expect = 1.8 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = -1 Query: 424 ERYLSSVLFQSIREECVKMEAEA 356 ERYLSSVLF S+R+E M E+ Sbjct: 303 ERYLSSVLFDSVRKEAESMVIES 325
>CYSK_SOLTU (O81154) Cysteine synthase (EC 2.5.1.47) (O-acetylserine| sulfhydrylase) (O-acetylserine (Thiol)-lyase) (CSase A) (CS-A) (OAS-TL A) Length = 325 Score = 30.0 bits (66), Expect = 2.3 Identities = 13/22 (59%), Positives = 16/22 (72%) Frame = -1 Query: 424 ERYLSSVLFQSIREECVKMEAE 359 ERYLSSVLF+++R E M E Sbjct: 303 ERYLSSVLFETVRREAENMTVE 324
>CYSK_WHEAT (P38076) Cysteine synthase (EC 2.5.1.47) (O-acetylserine| sulfhydrylase) (O-acetylserine (Thiol)-lyase) (CSase A) (OAS-TL A) Length = 325 Score = 29.6 bits (65), Expect = 3.0 Identities = 14/22 (63%), Positives = 16/22 (72%) Frame = -1 Query: 424 ERYLSSVLFQSIREECVKMEAE 359 ERYLSSVLF SI++E M E Sbjct: 304 ERYLSSVLFHSIKKEAESMVVE 325
>CYSK2_ORYSA (Q9XEA8) Cysteine synthase (EC 2.5.1.47) (O-acetylserine| sulfhydrylase) (O-acetylserine (Thiol)-lyase) (CSase) (OAS-TL) Length = 325 Score = 29.3 bits (64), Expect = 3.9 Identities = 14/22 (63%), Positives = 16/22 (72%) Frame = -1 Query: 424 ERYLSSVLFQSIREECVKMEAE 359 ERYLSSVLF+SI+ E M E Sbjct: 303 ERYLSSVLFESIKREAENMVFE 324
>CAC1H_HUMAN (O95180) Voltage-dependent T-type calcium channel alpha-1H subunit| (Voltage-gated calcium channel alpha subunit Cav3.2) (Low-voltage-activated calcium channel alpha1 3.2 subunit) Length = 2353 Score = 28.5 bits (62), Expect = 6.7 Identities = 14/52 (26%), Positives = 25/52 (48%), Gaps = 18/52 (34%) Frame = +2 Query: 248 SSVRSFPCPPY------------------SYSVRRRGRCSKKKGFFAGRGNG 349 +S+RS PC P+ + S++RRG+C +++ +G G G Sbjct: 1122 ASLRSSPCAPWGPSGAWSSRRSSWSSLGRAPSLKRRGQCGERESLLSGEGKG 1173
>VID21_EMENI (Q5B4Q8) Chromatin modification-related protein vid21| Length = 1447 Score = 28.5 bits (62), Expect = 6.7 Identities = 17/56 (30%), Positives = 26/56 (46%) Frame = +2 Query: 137 YNHAYHQRISIDTRNIIIVYQSTQQNASGLQKKTGVRSSVRSFPCPPYSYSVRRRG 304 Y AYHQRI RN++ + QQ Q++ ++ + P +RRRG Sbjct: 908 YFRAYHQRIDTAQRNVMAQQAAAQQQQQQQQQQGSNGNNQQPMPL------IRRRG 957
>NKTR_MOUSE (P30415) NK-tumor recognition protein (Natural-killer cells| cyclophilin-related protein) (NK-TR protein) Length = 1453 Score = 28.5 bits (62), Expect = 6.7 Identities = 22/86 (25%), Positives = 35/86 (40%), Gaps = 5/86 (5%) Frame = +3 Query: 168 STPGISSSYINRHSKMRAGSKKKRA*GRAFVRFHA-----RLILIRFDGEEDAAKKKASL 332 ST S + +H K + KK+A + R H R+++ + + S Sbjct: 419 STARHSDGHHKKHRKEKKFKHKKKAKKQKHCRRHRQTKKRRIVMPDLEPSRSPTHRMKSS 478 Query: 333 PGAEMALHASASIFTHSSLMDWNSTD 410 E AS+S HSS DW+ +D Sbjct: 479 CVRERRSRASSSSSHHSSKRDWSKSD 504 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 60,594,631 Number of Sequences: 219361 Number of extensions: 1142437 Number of successful extensions: 3555 Number of sequences better than 10.0: 15 Number of HSP's better than 10.0 without gapping: 3507 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3555 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2278320915 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)