| Clone Name | rbaet100f02 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | SET2_CAEEL (Q18221) Protein set-2 | 29 | 3.6 | 2 | MURE_WOLSU (Q7M8F9) UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-... | 28 | 4.7 | 3 | AMBN_RAT (Q62840) Ameloblastin precursor (Amelin) | 28 | 8.1 |
|---|
>SET2_CAEEL (Q18221) Protein set-2| Length = 1507 Score = 28.9 bits (63), Expect = 3.6 Identities = 19/71 (26%), Positives = 30/71 (42%) Frame = +1 Query: 7 QGDALSHHWFIFYKSPSPSSFPMGSDQHYNQQRIFAIPFHPSLVIQNQSTFVTRTPVRPF 186 Q A S F + P P S P + H++ + + P H S +N S V TP R Sbjct: 837 QSFASSSRGFYRKQKPIPKSHPKHQEHHHHAKASVSTPVHSSSTSRNSS--VAPTPQRTV 894 Query: 187 CS*ADKNCSTT 219 + + + + T Sbjct: 895 STSSSSSSAAT 905
>MURE_WOLSU (Q7M8F9) UDP-N-acetylmuramoylalanyl-D-glutamate--2,| 6-diaminopimelate ligase (EC 6.3.2.13) (UDP-N-acetylmuramyl-tripeptide synthetase) (Meso-diaminopimelate-adding enzyme) (UDP-MurNAc-tripeptide synthetase) Length = 434 Score = 28.5 bits (62), Expect = 4.7 Identities = 19/49 (38%), Positives = 22/49 (44%), Gaps = 10/49 (20%) Frame = +2 Query: 53 QVPAAFLWDRTSIIINK----------GSLRYPFIHHSSYKTKARSLHG 169 Q +F D T +INK +L Y H SSY KA SLHG Sbjct: 176 QTKNSFFDDSTPKLINKDESKAKFNLQNALSYGIEHPSSYHVKAYSLHG 224
>AMBN_RAT (Q62840) Ameloblastin precursor (Amelin)| Length = 422 Score = 27.7 bits (60), Expect = 8.1 Identities = 18/60 (30%), Positives = 30/60 (50%), Gaps = 1/60 (1%) Frame = +1 Query: 10 GDALSHHWFIFYKSPSPSSFP-MGSDQHYNQQRIFAIPFHPSLVIQNQSTFVTRTPVRPF 186 G AL+ W + P +SFP +G +H QQ +++P HP + S + ++PF Sbjct: 73 GKALNSLW-LHGLLPPHNSFPWIGPREHETQQYEYSLPVHPPPLPSQPSLQPHQPGLKPF 131 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 42,554,858 Number of Sequences: 219361 Number of extensions: 773066 Number of successful extensions: 1649 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1630 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1649 length of database: 80,573,946 effective HSP length: 62 effective length of database: 66,973,564 effective search space used: 1607365536 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)