| Clone Name | rbaet100a11 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | PAP2_HUMAN (Q9BXP8) Pappalysin-2 precursor (EC 3.4.24.-) (Pregna... | 29 | 5.1 | 2 | MTNN_TREPA (P96122) MTA/SAH nucleosidase (EC 3.2.2.9) (5'-methyl... | 28 | 8.8 |
|---|
>PAP2_HUMAN (Q9BXP8) Pappalysin-2 precursor (EC 3.4.24.-) (Pregnancy-associated| plasma protein-A2) (PAPP-A2) (Pregnancy-associated plasma protein-E1) (PAPP-E) Length = 1791 Score = 28.9 bits (63), Expect = 5.1 Identities = 10/24 (41%), Positives = 17/24 (70%) Frame = -2 Query: 380 VQALLRGRRRLTHPSPIILHCVAS 309 VQ+++ RR HP P+++HC+ S Sbjct: 1709 VQSIVCTGRRQWHPDPVLVHCIQS 1732
>MTNN_TREPA (P96122) MTA/SAH nucleosidase (EC 3.2.2.9) (5'-methylthioadenosine| nucleosidase) (S-adenosylhomocysteine nucleosidase) Length = 269 Score = 28.1 bits (61), Expect = 8.8 Identities = 13/35 (37%), Positives = 17/35 (48%) Frame = +1 Query: 238 TSNARLVIAAPD*FSLCDRRPSWTDATQCRMMGDG 342 T+N L + F LC R P WT+ C + G G Sbjct: 120 TANTALRYLVREAFDLCTRDPEWTEGA-CALSGSG 153 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 52,039,508 Number of Sequences: 219361 Number of extensions: 972269 Number of successful extensions: 2266 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2242 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2266 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2278320915 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)