| Clone Name | rbaet09f03 |
|---|---|
| Clone Library Name | barley_pub |
>HSP2_MURBR (P83212) Sperm protamine P2| Length = 58 Score = 32.7 bits (73), Expect = 0.36 Identities = 14/44 (31%), Positives = 27/44 (61%) Frame = -3 Query: 281 RAQRRGEERSSKRDSQGRRRGCRVWPGARGGRRRNKTGRELSRK 150 R +RRG+ R KR +G++RG G++G +++ G++ R+ Sbjct: 2 RRRRRGKGRGKKRKGKGKKRGKGRRRGSKGRKKKKGKGKKRKRR 45
>VTS1_YEAST (Q08831) Protein VTS1 (VTI1-2 suppressor protein 1)| Length = 523 Score = 31.2 bits (69), Expect = 1.0 Identities = 17/47 (36%), Positives = 24/47 (51%) Frame = +2 Query: 17 SYEIFEPSPRKKEKTAC*NHHRHRLHAHPIVASSTSIYTKHTSIPFG 157 S+ F+P R +HH H LH HP+ +T+ Y +TS P G Sbjct: 355 SHSFFQPKKRSNMGNEYNSHHHHSLH-HPL--HNTTSYFSNTSRPSG 398
>HSP1_CHRPI (Q7LZB2) Sperm protamine P1-type (Protamine I-1)| Length = 58 Score = 30.4 bits (67), Expect = 1.8 Identities = 17/44 (38%), Positives = 24/44 (54%) Frame = -3 Query: 281 RAQRRGEERSSKRDSQGRRRGCRVWPGARGGRRRNKTGRELSRK 150 R++ R R +R +G RRG R G RRR + GRE +R+ Sbjct: 7 RSRSRSRRRRRRRGGRGGRRGRR--RRRHGQRRRGRRGRERTRR 48
>HSP1_PSECU (P42145) Sperm protamine P1| Length = 68 Score = 30.0 bits (66), Expect = 2.3 Identities = 19/43 (44%), Positives = 24/43 (55%) Frame = -3 Query: 281 RAQRRGEERSSKRDSQGRRRGCRVWPGARGGRRRNKTGRELSR 153 R +RR RS +R +GRRRG + G RG RRR + R R Sbjct: 26 RGRRRRYRRSRRRRRRGRRRGNCL--GRRGYRRRRYSRRRRRR 66
>RSRC1_RAT (Q5PPJ2) Arginine/serine-rich coiled coil protein 1| Length = 334 Score = 29.6 bits (65), Expect = 3.0 Identities = 17/54 (31%), Positives = 26/54 (48%) Frame = -3 Query: 314 GMESMDSDSE*RAQRRGEERSSKRDSQGRRRGCRVWPGARGGRRRNKTGRELSR 153 G S D++ E R++R+ + R +R S R + +GGRR R SR Sbjct: 2 GRRSSDTEEESRSKRKKKHR--RRSSSSSSSDSRTYSRKKGGRRPRSESRSWSR 53
>RSRC1_MOUSE (Q9DBU6) Arginine/serine-rich coiled coil protein 1| Length = 334 Score = 29.6 bits (65), Expect = 3.0 Identities = 17/54 (31%), Positives = 26/54 (48%) Frame = -3 Query: 314 GMESMDSDSE*RAQRRGEERSSKRDSQGRRRGCRVWPGARGGRRRNKTGRELSR 153 G S D++ E R++R+ + R +R S R + +GGRR R SR Sbjct: 2 GRRSSDTEEESRSKRKKKHR--RRSSSSSSSDSRTYSRKKGGRRPRSDSRSWSR 53
>SUWA_DROME (P12297) Protein suppressor of white apricot| Length = 963 Score = 29.6 bits (65), Expect = 3.0 Identities = 19/48 (39%), Positives = 26/48 (54%) Frame = -2 Query: 399 GDVALGFDQKPLRGAREEMCQEEAKRAERDGEHGQRLGVKSAKKRRGE 256 GDV L D+ +RGA E+ EA G +G RL SA+++R E Sbjct: 90 GDVNLKIDRYDVRGALCELAPHEAP----PGGYGNRLEYLSAEEQRAE 133
>RU17_XENTR (Q66II8) U1 small nuclear ribonucleoprotein 70 kDa (U1 snRNP 70| kDa) (snRNP70) (U1-70K) Length = 471 Score = 29.3 bits (64), Expect = 3.9 Identities = 20/53 (37%), Positives = 25/53 (47%) Frame = -3 Query: 308 ESMDSDSE*RAQRRGEERSSKRDSQGRRRGCRVWPGARGGRRRNKTGRELSRK 150 + D D E RR ERS +RD + RR R R R R K R+ SR+ Sbjct: 220 DERDRDRERERDRR--ERSRERDKERERRRSRSRERRRRSRSREKEERKRSRE 270
>RSRC1_HUMAN (Q96IZ7) Arginine/serine-rich coiled coil protein 1| Length = 334 Score = 28.9 bits (63), Expect = 5.2 Identities = 16/54 (29%), Positives = 26/54 (48%) Frame = -3 Query: 314 GMESMDSDSE*RAQRRGEERSSKRDSQGRRRGCRVWPGARGGRRRNKTGRELSR 153 G S D++ E R++R+ + R +R S R + +GGR+ R SR Sbjct: 2 GRRSSDTEEESRSKRKKKHR--RRSSSSSSSDSRTYSRKKGGRKSRSKSRSWSR 53
>KCTD2_MOUSE (Q8CEZ0) Potassium channel tetramerisation domain-containing| protein 2 Length = 266 Score = 28.9 bits (63), Expect = 5.2 Identities = 20/66 (30%), Positives = 28/66 (42%), Gaps = 2/66 (3%) Frame = -3 Query: 320 LKGMESMDSDSE*RAQRRGEERSSKRDSQGRRRGCRVWPGARGGRRRNKTGRELSR--KE 147 L+G D+ + R R+ + GRRRG + P RG T + L R K Sbjct: 36 LRGRHPADTAASPPPPRTAGARARTSGADGRRRGRPLGPAQRGRYLLRDTRQTLGREPKS 95 Query: 146 WTCVLC 129 + C LC Sbjct: 96 FLCRLC 101
>AA2DA_BRARE (Q8JG70) Alpha-2Da adrenergic receptor (Alpha-2Da adrenoceptor)| (Alpha-2Da adrenoreceptor) (Alpha(2Da)AR) Length = 408 Score = 28.9 bits (63), Expect = 5.2 Identities = 22/66 (33%), Positives = 34/66 (51%), Gaps = 7/66 (10%) Frame = -3 Query: 308 ESMDSDSE*RAQRRGEERSSKRDSQGRRRGCRV-W-----PGARGGRRRNKTG-RELSRK 150 ES SDS R R + R + + +G +R CRV W PG+R + +K+ ++ K Sbjct: 268 ESAASDSRARGSRFSKRRRVEGERRGPQRSCRVSWAAHQEPGSRQQQLASKSKVAQMREK 327 Query: 149 EWTCVL 132 +T VL Sbjct: 328 RFTFVL 333
>RU17_MOUSE (Q62376) U1 small nuclear ribonucleoprotein 70 kDa (U1 SNRNP 70| kDa) (snRNP70) Length = 448 Score = 28.5 bits (62), Expect = 6.7 Identities = 19/50 (38%), Positives = 25/50 (50%) Frame = -3 Query: 299 DSDSE*RAQRRGEERSSKRDSQGRRRGCRVWPGARGGRRRNKTGRELSRK 150 D D + +RR ERS +RD + RR R R R R+K R SR+ Sbjct: 232 DRDRDRERERR--ERSRERDKERERRRSRSRDRRRRSRSRDKDERRRSRE 279
>NKTR_HUMAN (P30414) NK-tumor recognition protein (Natural-killer cells| cyclophilin-related protein) (NK-TR protein) Length = 1462 Score = 28.5 bits (62), Expect = 6.7 Identities = 19/58 (32%), Positives = 25/58 (43%), Gaps = 2/58 (3%) Frame = -2 Query: 384 GFDQKPLRGAREEMCQEEAKRAERDG--EHGQRLGVKSAKKRRGEV*QARQPRKKTGM 217 G D + E E ER +H +R VK +KKRR E + +PR K M Sbjct: 197 GSDSSSNSSSSSESSSESELEHERSRRRKHKRRPKVKRSKKRRKEASSSEEPRNKHAM 254
>IWS1_EMENI (Q5BEG5) Transcription factor iws1| Length = 429 Score = 28.5 bits (62), Expect = 6.7 Identities = 19/55 (34%), Positives = 25/55 (45%), Gaps = 8/55 (14%) Frame = -3 Query: 281 RAQRRGEERSSKRDSQGRRRGCRVWPGAR--------GGRRRNKTGRELSRKEWT 141 + +R EE +SKR +GRRR R + GG+RR EL E T Sbjct: 91 KRKRTEEEGTSKRKKEGRRRKSRRYAEEEEGGSDREAGGKRRKSKKAELEEDEET 145
>RU17_HUMAN (P08621) U1 small nuclear ribonucleoprotein 70 kDa (U1 snRNP 70| kDa) (snRNP70) (U1-70K) Length = 437 Score = 28.5 bits (62), Expect = 6.7 Identities = 19/50 (38%), Positives = 25/50 (50%) Frame = -3 Query: 299 DSDSE*RAQRRGEERSSKRDSQGRRRGCRVWPGARGGRRRNKTGRELSRK 150 D D + +RR ERS +RD + RR R R R R+K R SR+ Sbjct: 232 DRDRDRERERR--ERSRERDKERERRRSRSRDRRRRSRSRDKEERRRSRE 279
>HSP1_PLAMS (O18746) Sperm protamine P1| Length = 61 Score = 28.5 bits (62), Expect = 6.7 Identities = 18/37 (48%), Positives = 21/37 (56%), Gaps = 3/37 (8%) Frame = -3 Query: 281 RAQRRGEERSSKRDSQ---GRRRGCRVWPGARGGRRR 180 R RR R S+R S+ GRRRGC +R GRRR Sbjct: 24 RYNRRRTYRRSRRHSRRRRGRRRGCSRRRYSRRGRRR 60
>HSP1_OCTVU (P83214) Sperm protamine P1 (Po1) [Contains: Sperm protamine P2| (Po2) (Main protamine)] Length = 56 Score = 28.5 bits (62), Expect = 6.7 Identities = 18/36 (50%), Positives = 21/36 (58%) Frame = -3 Query: 281 RAQRRGEERSSKRDSQGRRRGCRVWPGARGGRRRNK 174 R +RRG R +R GRRRG R RGGRRR + Sbjct: 25 RGRRRGRRRGRRR---GRRRGRRR-RRRRGGRRRRR 56 Score = 28.5 bits (62), Expect = 6.7 Identities = 17/36 (47%), Positives = 19/36 (52%) Frame = -3 Query: 272 RRGEERSSKRDSQGRRRGCRVWPGARGGRRRNKTGR 165 RR R R +GRRRG R G R GRRR + R Sbjct: 13 RRRRRRRRSRGRRGRRRGRR--RGRRRGRRRGRRRR 46
>NKTR_MOUSE (P30415) NK-tumor recognition protein (Natural-killer cells| cyclophilin-related protein) (NK-TR protein) Length = 1453 Score = 28.1 bits (61), Expect = 8.8 Identities = 16/43 (37%), Positives = 24/43 (55%), Gaps = 1/43 (2%) Frame = -2 Query: 351 EEMCQEEAKRAE-RDGEHGQRLGVKSAKKRRGEV*QARQPRKK 226 E + E +R R H +R V+ AKKRR E+ + +PR+K Sbjct: 209 ESSSESEVERETIRRRRHKRRPKVRHAKKRRKEMSSSEEPRRK 251
>EBNA1_EBV (P03211) Epstein-Barr nuclear antigen 1 (EBV nuclear antigen 1)| (EBNA-1) Length = 641 Score = 28.1 bits (61), Expect = 8.8 Identities = 19/53 (35%), Positives = 27/53 (50%), Gaps = 3/53 (5%) Frame = -3 Query: 275 QRRGEERSSKRDSQGRRRGCRVWPGARGGRR---RNKTGRELSRKEWTCVLCK 126 QRRG + + +GR RG PGA GG R++ G +K +C+ CK Sbjct: 32 QRRGGDNHGRGRGRGRGRGGGR-PGAPGGSGSGPRHRDGVRRPQKRPSCIGCK 83
>SVIL_HUMAN (O95425) Supervillin (Archvillin) (p205/p250)| Length = 2214 Score = 28.1 bits (61), Expect = 8.8 Identities = 15/36 (41%), Positives = 20/36 (55%) Frame = -1 Query: 256 GLASETAKEEDGDAVCGRERGVVGEETKPVESLAER 149 GLAS TA A+CG+ RG +KP+E + R Sbjct: 1222 GLASPTAITPVASAICGKTRGTT-PVSKPLEDIEAR 1256 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 53,596,355 Number of Sequences: 219361 Number of extensions: 890123 Number of successful extensions: 2910 Number of sequences better than 10.0: 20 Number of HSP's better than 10.0 without gapping: 2777 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2905 length of database: 80,573,946 effective HSP length: 100 effective length of database: 58,637,846 effective search space used: 2286875994 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)