| Clone Name | rbaet09f02 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | YIAH_ECOLI (P37669) Inner membrane protein yiaH | 32 | 0.83 | 2 | EPIPL_MOUSE (Q8R0W0) Epiplakin | 31 | 1.4 | 3 | EREG_MOUSE (Q61521) Epiregulin precursor | 29 | 4.1 | 4 | IAP1_NPVOP (O10296) Apoptosis inhibitor 1 (IAP-1) | 28 | 9.2 | 5 | EREG_HUMAN (O14944) Epiregulin precursor | 28 | 9.2 |
|---|
>YIAH_ECOLI (P37669) Inner membrane protein yiaH| Length = 331 Score = 31.6 bits (70), Expect = 0.83 Identities = 19/60 (31%), Positives = 26/60 (43%), Gaps = 10/60 (16%) Frame = +2 Query: 74 IHTPTFRQTNKHCLSPVTW----------RVTAPIQLLRGRVCILNVSSLSQKKALRAGV 223 IHT T+ TN H +SPVTW RV+ P+ + S + LR G+ Sbjct: 22 IHTTTWYVTNAHSVSPVTWDIANVLNSASRVSVPLFFMISGYLFFGERSAQPRHFLRIGL 81
>EPIPL_MOUSE (Q8R0W0) Epiplakin| Length = 6548 Score = 30.8 bits (68), Expect = 1.4 Identities = 13/39 (33%), Positives = 22/39 (56%) Frame = +1 Query: 106 ALPVPGNVARDRTHSITSWPCLHSQCIFALSKKSPACRC 222 A+ VP N+ R + HS++ W LHS+ + A ++ C Sbjct: 1460 AMKVPINMGRFQGHSVSLWDLLHSEYVGAEKRRELVALC 1498
>EREG_MOUSE (Q61521) Epiregulin precursor| Length = 162 Score = 29.3 bits (64), Expect = 4.1 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +1 Query: 166 CLHSQCIFALSKKSPACRCK 225 CLH QCI+ + + CRC+ Sbjct: 69 CLHGQCIYLVDMREKFCRCE 88
>IAP1_NPVOP (O10296) Apoptosis inhibitor 1 (IAP-1)| Length = 275 Score = 28.1 bits (61), Expect = 9.2 Identities = 19/60 (31%), Positives = 24/60 (40%), Gaps = 4/60 (6%) Frame = +1 Query: 52 AHTSPGRNSHAHLPTNQ*ALPVPGNVARDRTHSITSWPCLH----SQCIFALSKKSPACR 219 A T+PG + A + + V +R PC H QC FAL K P CR Sbjct: 208 AETAPGEPAPAFAGSEA----LECKVCLERQRDAVLLPCRHFCVCMQCYFALDGKCPTCR 263
>EREG_HUMAN (O14944) Epiregulin precursor| Length = 169 Score = 28.1 bits (61), Expect = 9.2 Identities = 9/20 (45%), Positives = 12/20 (60%) Frame = +1 Query: 166 CLHSQCIFALSKKSPACRCK 225 CLH QCI+ + CRC+ Sbjct: 76 CLHGQCIYLVDMSQNYCRCE 95 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 46,989,586 Number of Sequences: 219361 Number of extensions: 844228 Number of successful extensions: 2174 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 2130 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2173 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2395157885 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)