ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | rbaet09a01 |
|---|---|
| Clone Library Name | barley_pub |
>PIP1_ATRCA (P42767) Aquaporin PIP-type| Length = 282 Score = 48.9 bits (115), Expect = 6e-06 Identities = 25/27 (92%), Positives = 26/27 (96%), Gaps = 1/27 (3%) Frame = -1 Query: 451 VGPFVGALAAA-YHQYILRAAAIKALG 374 VGPFVGALAAA YHQY+LRAAAIKALG Sbjct: 248 VGPFVGALAAAAYHQYVLRAAAIKALG 274
>PIP26_ORYSA (Q7XLR1) Probable aquaporin PIP2.6 (Plasma membrane intrinsic| protein 2.6) (OsPIP2.6) Length = 282 Score = 47.4 bits (111), Expect = 2e-05 Identities = 24/26 (92%), Positives = 25/26 (96%), Gaps = 1/26 (3%) Frame = -1 Query: 448 GPFVGALAAA-YHQYILRAAAIKALG 374 GPF+GALAAA YHQYILRAAAIKALG Sbjct: 249 GPFIGALAAAAYHQYILRAAAIKALG 274
>PIP28_ARATH (Q9ZVX8) Probable aquaporin PIP2.8 (Plasma membrane intrinsic| protein 3b) (PIP3b) Length = 278 Score = 47.0 bits (110), Expect = 2e-05 Identities = 25/26 (96%), Positives = 25/26 (96%), Gaps = 1/26 (3%) Frame = -1 Query: 451 VGPFVGALAAA-YHQYILRAAAIKAL 377 VGPFVGALAAA YHQYILRAAAIKAL Sbjct: 244 VGPFVGALAAAAYHQYILRAAAIKAL 269
>PIP27_ARATH (P93004) Aquaporin PIP2.7 (Plasma membrane intrinsic protein 3)| (Salt stress-induced major intrinsic protein) Length = 280 Score = 47.0 bits (110), Expect = 2e-05 Identities = 24/27 (88%), Positives = 26/27 (96%), Gaps = 1/27 (3%) Frame = -1 Query: 451 VGPFVGALAAA-YHQYILRAAAIKALG 374 VGPF+GALAAA YHQYILRA+AIKALG Sbjct: 246 VGPFLGALAAAAYHQYILRASAIKALG 272
>PIP21_ORYSA (Q8H5N9) Probable aquaporin PIP2.1 (Plasma membrane intrinsic| protein 2a) (PIP2a) (OsPIP2.1) Length = 290 Score = 44.7 bits (104), Expect = 1e-04 Identities = 23/27 (85%), Positives = 24/27 (88%), Gaps = 1/27 (3%) Frame = -1 Query: 451 VGPFVGA-LAAAYHQYILRAAAIKALG 374 VGPFVGA +AA YHQYILRA AIKALG Sbjct: 258 VGPFVGAAIAAFYHQYILRAGAIKALG 284
>PIP24_ARATH (Q9FF53) Probable aquaporin PIP2.4 (Plasma membrane intrinsic| protein 2.4) Length = 291 Score = 43.1 bits (100), Expect = 3e-04 Identities = 22/27 (81%), Positives = 24/27 (88%), Gaps = 1/27 (3%) Frame = -1 Query: 451 VGPFVGALAAA-YHQYILRAAAIKALG 374 VGP +GA AAA YHQ+ILRAAAIKALG Sbjct: 253 VGPMIGAAAAAFYHQFILRAAAIKALG 279
>PIP25_ARATH (Q9SV31) Probable aquaporin PIP2.5 (Plasma membrane intrinsic| protein 2d) (PIP2d) Length = 286 Score = 41.2 bits (95), Expect = 0.001 Identities = 20/27 (74%), Positives = 23/27 (85%), Gaps = 1/27 (3%) Frame = -1 Query: 451 VGPFVGA-LAAAYHQYILRAAAIKALG 374 VGPF GA +AA YHQ++LRA AIKALG Sbjct: 252 VGPFAGAAIAAFYHQFVLRAGAIKALG 278
>PIP26_ARATH (Q9ZV07) Probable aquaporin PIP2.6 (Plasma membrane intrinsic| protein 2e) (PIP2e) Length = 289 Score = 39.7 bits (91), Expect = 0.003 Identities = 19/27 (70%), Positives = 23/27 (85%), Gaps = 1/27 (3%) Frame = -1 Query: 451 VGPFVGA-LAAAYHQYILRAAAIKALG 374 VGPFVGA +AA YHQ++LRA A+KA G Sbjct: 252 VGPFVGAAIAAFYHQFVLRAGAMKAYG 278
>PIP23_ARATH (P30302) Aquaporin PIP2.3 (Plasma membrane intrinsic protein 2c)| (PIP2c) (TMP2C) (RD28-PIP) (Water stress-induced tonoplast intrinsic protein) (WSI-TIP) Length = 285 Score = 37.7 bits (86), Expect = 0.013 Identities = 17/27 (62%), Positives = 23/27 (85%), Gaps = 1/27 (3%) Frame = -1 Query: 451 VGPFVGA-LAAAYHQYILRAAAIKALG 374 VGPF+GA +AA YHQ++LRA+ K+LG Sbjct: 251 VGPFIGATIAAFYHQFVLRASGSKSLG 277
>PIP22_ARATH (P43287) Aquaporin PIP2.2 (Plasma membrane intrinsic protein 2b)| (PIP2b) (TMP2b) Length = 285 Score = 37.7 bits (86), Expect = 0.013 Identities = 17/27 (62%), Positives = 23/27 (85%), Gaps = 1/27 (3%) Frame = -1 Query: 451 VGPFVGA-LAAAYHQYILRAAAIKALG 374 VGPF+GA +AA YHQ++LRA+ K+LG Sbjct: 251 VGPFIGAAIAAFYHQFVLRASGSKSLG 277
>PIP21_ARATH (P43286) Aquaporin PIP2.1 (Plasma membrane intrinsic protein 2a)| (PIP2a) Length = 287 Score = 37.7 bits (86), Expect = 0.013 Identities = 17/27 (62%), Positives = 23/27 (85%), Gaps = 1/27 (3%) Frame = -1 Query: 451 VGPFVGA-LAAAYHQYILRAAAIKALG 374 VGPF+GA +AA YHQ++LRA+ K+LG Sbjct: 253 VGPFIGAAIAAFYHQFVLRASGSKSLG 279
>PIP23_ORYSA (Q7XUA6) Probable aquaporin PIP2.3 (Plasma membrane intrinsic| protein 2.3) (OsPIP2.3) Length = 290 Score = 37.0 bits (84), Expect = 0.023 Identities = 17/24 (70%), Positives = 21/24 (87%), Gaps = 1/24 (4%) Frame = -1 Query: 451 VGPFVGA-LAAAYHQYILRAAAIK 383 VGP +GA +AAAYHQY+LRA+A K Sbjct: 258 VGPLIGAAIAAAYHQYVLRASAAK 281
>PIP22_ORYSA (Q6K215) Probable aquaporin PIP2.2 (Plasma membrane intrinsic| protein 2.2) (OsPIP2.2) Length = 288 Score = 37.0 bits (84), Expect = 0.023 Identities = 17/24 (70%), Positives = 21/24 (87%), Gaps = 1/24 (4%) Frame = -1 Query: 451 VGPFVGA-LAAAYHQYILRAAAIK 383 VGP +GA +AAAYHQY+LRA+A K Sbjct: 257 VGPLIGAAIAAAYHQYVLRASAAK 280
>PIP28_ORYSA (Q7Y1E6) Probable aquaporin PIP2.8 (Plasma membrane intrinsic| protein 2.8) (OsPIP2.8) Length = 280 Score = 34.7 bits (78), Expect = 0.11 Identities = 18/25 (72%), Positives = 18/25 (72%), Gaps = 1/25 (4%) Frame = -1 Query: 451 VGPFVGALAAA-YHQYILRAAAIKA 380 VGPF GA AA YH YILR AA KA Sbjct: 245 VGPFAGAAAAMIYHHYILRGAAAKA 269
>PIP27_ORYSA (Q651D5) Probable aquaporin PIP2.7 (Plasma membrane intrinsic| protein 2.7) (OsPIP2.7) Length = 290 Score = 33.5 bits (75), Expect = 0.25 Identities = 17/26 (65%), Positives = 20/26 (76%), Gaps = 1/26 (3%) Frame = -1 Query: 451 VGPFVGA-LAAAYHQYILRAAAIKAL 377 VGP +GA LAAAYH+ +LR A KAL Sbjct: 255 VGPVIGAFLAAAYHKLVLRGEAAKAL 280
>PIP24_ORYSA (Q8GRT8) Aquaporin PIP2.4 (Plasma membrane intrinsic protein 2.4)| (OsPIP2.4) Length = 286 Score = 33.1 bits (74), Expect = 0.33 Identities = 16/22 (72%), Positives = 19/22 (86%), Gaps = 1/22 (4%) Frame = -1 Query: 451 VGPFVG-ALAAAYHQYILRAAA 389 VGPF+G A+AA YHQ ILRA+A Sbjct: 255 VGPFIGAAIAALYHQVILRASA 276
>PIP11_ORYSA (Q6EU94) Aquaporin PIP1.1 (Plasma membrane intrinsic protein 1a)| (PIP1a) (OsPIP1.1) (Water channel protein RWC1) (RWC-1) Length = 289 Score = 33.1 bits (74), Expect = 0.33 Identities = 17/25 (68%), Positives = 19/25 (76%), Gaps = 1/25 (4%) Frame = -1 Query: 451 VGPFVGA-LAAAYHQYILRAAAIKA 380 VGPFVGA LAA YHQ I+RA K+ Sbjct: 263 VGPFVGAALAAIYHQVIIRAIPFKS 287
>PIP25_ORYSA (Q8GRI8) Aquaporin PIP2.5 (Plasma membrane intrinsic protein 2.5)| (OsPIP2.5) Length = 283 Score = 32.7 bits (73), Expect = 0.43 Identities = 15/22 (68%), Positives = 19/22 (86%), Gaps = 1/22 (4%) Frame = -1 Query: 451 VGPFVG-ALAAAYHQYILRAAA 389 VGPF+G A+AA YHQ +LRA+A Sbjct: 252 VGPFIGAAIAALYHQIVLRASA 273
>PIP13_ARATH (Q08733) Aquaporin PIP1.3 (Plasma membrane intrinsic protein 1c)| (PIP1c) (Transmembrane protein B) (TMP-B) Length = 286 Score = 32.3 bits (72), Expect = 0.56 Identities = 15/25 (60%), Positives = 19/25 (76%), Gaps = 1/25 (4%) Frame = -1 Query: 451 VGPFVGA-LAAAYHQYILRAAAIKA 380 VGPF+GA LAA YHQ ++RA K+ Sbjct: 260 VGPFIGAALAALYHQLVIRAIPFKS 284
>PIP15_ARATH (Q8LAA6) Probable aquaporin PIP1.5 (Plasma membrane intrinsic| protein 1d) (PIP1d) Length = 287 Score = 32.3 bits (72), Expect = 0.56 Identities = 15/25 (60%), Positives = 19/25 (76%), Gaps = 1/25 (4%) Frame = -1 Query: 451 VGPFVGA-LAAAYHQYILRAAAIKA 380 VGPF+GA LAA YHQ ++RA K+ Sbjct: 261 VGPFIGAALAALYHQIVIRAIPFKS 285
>PIP14_ARATH (Q39196) Probable aquaporin PIP1.4 (Plasma membrane intrinsic| protein 1.4) (Transmembrane protein C) (TMP-C) Length = 287 Score = 32.3 bits (72), Expect = 0.56 Identities = 15/25 (60%), Positives = 19/25 (76%), Gaps = 1/25 (4%) Frame = -1 Query: 451 VGPFVGA-LAAAYHQYILRAAAIKA 380 VGPF+GA LAA YHQ ++RA K+ Sbjct: 261 VGPFIGAALAALYHQIVIRAIPFKS 285
>PIP2_PEA (P25794) Probable aquaporin PIP-type 7a (Turgor-responsive protein| 7a) (Turgor-responsive protein 31) Length = 289 Score = 32.3 bits (72), Expect = 0.56 Identities = 15/25 (60%), Positives = 19/25 (76%), Gaps = 1/25 (4%) Frame = -1 Query: 451 VGPFVGA-LAAAYHQYILRAAAIKA 380 VGPF+GA LAA YHQ ++RA K+ Sbjct: 264 VGPFIGAALAALYHQVVIRAIPFKS 288
>PIP12_ORYSA (Q7XSQ9) Probable aquaporin PIP1.2 (Plasma membrane intrinsic| protein 1.2) (OsPIP1.2) Length = 282 Score = 32.3 bits (72), Expect = 0.56 Identities = 15/25 (60%), Positives = 19/25 (76%), Gaps = 1/25 (4%) Frame = -1 Query: 451 VGPFVGA-LAAAYHQYILRAAAIKA 380 VGPF+GA LAA YHQ ++RA K+ Sbjct: 256 VGPFIGAALAAIYHQVVIRAIPFKS 280
>SMYD4_PONPY (Q5R5X9) SET and MYND domain-containing protein 4| Length = 804 Score = 30.8 bits (68), Expect = 1.6 Identities = 10/19 (52%), Positives = 12/19 (63%) Frame = +1 Query: 310 YCHRCIKLLAGVLSCSGCS 366 YCHRC+K + C GCS Sbjct: 295 YCHRCLKHTLATVPCDGCS 313
>SMYD4_HUMAN (Q8IYR2) SET and MYND domain-containing protein 4| Length = 804 Score = 30.8 bits (68), Expect = 1.6 Identities = 10/19 (52%), Positives = 12/19 (63%) Frame = +1 Query: 310 YCHRCIKLLAGVLSCSGCS 366 YCHRC+K + C GCS Sbjct: 295 YCHRCLKHTLATVPCDGCS 313
>SMYD4_CHICK (Q5F3V0) SET and MYND domain-containing protein 4| Length = 742 Score = 30.4 bits (67), Expect = 2.1 Identities = 10/19 (52%), Positives = 12/19 (63%) Frame = +1 Query: 310 YCHRCIKLLAGVLSCSGCS 366 YCH C+K L + C GCS Sbjct: 294 YCHHCLKQLLASIPCCGCS 312
>PIP13_ORYSA (Q9SXF8) Aquaporin PIP 1.3 (Plasma membrane intrinsic protein 1.3)| (OsPIP1.3) (Water channel protein RWC3) (RWC-3) Length = 288 Score = 29.6 bits (65), Expect = 3.6 Identities = 14/25 (56%), Positives = 18/25 (72%), Gaps = 1/25 (4%) Frame = -1 Query: 451 VGPFVG-ALAAAYHQYILRAAAIKA 380 VGPF+G ALAA YH ++RA K+ Sbjct: 262 VGPFIGAALAAIYHVVVIRAIPFKS 286
>PIP12_ARATH (Q06611) Aquaporin PIP1.2 (Plasma membrane intrinsic protein 1b)| (PIP1b) (Transmembrane protein A) (TMP-A) (AthH2) Length = 286 Score = 29.6 bits (65), Expect = 3.6 Identities = 14/25 (56%), Positives = 18/25 (72%), Gaps = 1/25 (4%) Frame = -1 Query: 451 VGPFVG-ALAAAYHQYILRAAAIKA 380 VGPF+G ALAA YH ++RA K+ Sbjct: 260 VGPFIGAALAALYHVIVIRAIPFKS 284
>PIP11_VICFA (P61838) Aquaporin PIP1.1 (Plasma membrane intrinsic protein 1a)| (PIP1a) (Aquaporin 1) (Plasma membrane aquaporin 1) Length = 286 Score = 29.6 bits (65), Expect = 3.6 Identities = 14/25 (56%), Positives = 18/25 (72%), Gaps = 1/25 (4%) Frame = -1 Query: 451 VGPFVG-ALAAAYHQYILRAAAIKA 380 VGPF+G ALAA YH ++RA K+ Sbjct: 260 VGPFIGAALAALYHVVVIRAIPFKS 284
>PIP11_ARATH (P61837) Aquaporin PIP1.1 (Plasma membrane intrinsic protein 1a)| (PIP1a) (Aquaporin 1) (Plasma membrane aquaporin 1) Length = 286 Score = 29.6 bits (65), Expect = 3.6 Identities = 14/25 (56%), Positives = 18/25 (72%), Gaps = 1/25 (4%) Frame = -1 Query: 451 VGPFVG-ALAAAYHQYILRAAAIKA 380 VGPF+G ALAA YH ++RA K+ Sbjct: 260 VGPFIGAALAALYHVVVIRAIPFKS 284
>UBR1_CAEEL (P91133) Ubiquitin-protein ligase E3 component N-recognin (EC| 6.-.-.-) (Ubiquitin-protein ligase E3-alpha) Length = 1927 Score = 29.6 bits (65), Expect = 3.6 Identities = 16/49 (32%), Positives = 22/49 (44%) Frame = -3 Query: 368 PEQPEQLSTPANNLMQRWQYCSSCPSGAS*PHKRTGFVLAVLLLHRAHP 222 P +P+ TP + L+ S P+ A PH T F V L + A P Sbjct: 1560 PPRPKLAQTPGSPLLSAPSTSSFTPAPAQIPHSGTNFAFLVQLFNPAGP 1608
>PIP1_LYCES (Q08451) Probable aquaporin PIP-type pTOM75 (Ripening-associated| membrane protein) (RAMP) Length = 286 Score = 28.9 bits (63), Expect = 6.2 Identities = 14/20 (70%), Positives = 16/20 (80%), Gaps = 1/20 (5%) Frame = -1 Query: 451 VGPFVGA-LAAAYHQYILRA 395 VGP +GA LAA YHQ I+RA Sbjct: 261 VGPMIGAALAAIYHQIIIRA 280
>CATA_BACST (P14412) Peroxidase/catalase (EC 1.11.1.6) (Catalase-peroxidase)| Length = 735 Score = 28.9 bits (63), Expect = 6.2 Identities = 9/22 (40%), Positives = 15/22 (68%) Frame = +2 Query: 170 WWPLSLSLTCMHRH*TRPDGHD 235 WWP L+L+ +H+H + + HD Sbjct: 31 WWPNQLNLSILHQHDRKTNPHD 52
>SMYD4_MOUSE (Q8BTK5) SET and MYND domain-containing protein 4| Length = 799 Score = 28.5 bits (62), Expect = 8.1 Identities = 9/19 (47%), Positives = 11/19 (57%) Frame = +1 Query: 310 YCHRCIKLLAGVLSCSGCS 366 YCHRC+K + C CS Sbjct: 295 YCHRCLKHTLATVPCGSCS 313
>TELT_MOUSE (O70548) Telethonin (Titin cap protein)| Length = 167 Score = 28.5 bits (62), Expect = 8.1 Identities = 13/39 (33%), Positives = 17/39 (43%) Frame = +1 Query: 205 QTLNEAGWARWRSSTANTKPVRLCG*LAPDGHEEQYCHR 321 Q EA WA W+ T +T+P C D + HR Sbjct: 15 QERREAFWAEWKDLTLSTRPEEGCSLHEEDTQRHETYHR 53 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 57,126,923 Number of Sequences: 219361 Number of extensions: 1061015 Number of successful extensions: 2660 Number of sequences better than 10.0: 35 Number of HSP's better than 10.0 without gapping: 2557 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2634 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2735358828 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
