| Clone Name | rbaet08h11 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | ALG10_CANAL (Q59YV2) Alpha-1,2 glucosyltransferase ALG10 (EC 2.4... | 30 | 1.9 | 2 | PDYN_PIG (P01214) Beta-neoendorphin-dynorphin precursor (Proenke... | 27 | 9.5 |
|---|
>ALG10_CANAL (Q59YV2) Alpha-1,2 glucosyltransferase ALG10 (EC 2.4.1.-)| (Alpha-2-glucosyltransferase ALG10) (Dolichyl-phosphoglucose-dependent glucosyltransferase ALG10) (Asparagine-linked glycosylation protein 10) Length = 450 Score = 29.6 bits (65), Expect = 1.9 Identities = 12/37 (32%), Positives = 20/37 (54%) Frame = -1 Query: 125 DSHRWSFHFVLLLYCVTNQAWSWFP*WLHGNNIKIFF 15 D+H+ H V + YC T + P WL+ + IK ++ Sbjct: 269 DNHQIELHIVQVFYCFTFITFFTIPNWLNKSTIKKYY 305
>PDYN_PIG (P01214) Beta-neoendorphin-dynorphin precursor (Proenkephalin B)| (Preprodynorphin) [Contains: Beta-neoendorphin; Dynorphin; Leu-enkephalin; Rimorphin; Leumorphin] Length = 256 Score = 27.3 bits (59), Expect = 9.5 Identities = 9/25 (36%), Positives = 16/25 (64%) Frame = -3 Query: 186 PQVRTDACSGCNICSLKSRVGFTPV 112 P D SGC++C++K++ G P+ Sbjct: 16 PSTMADCLSGCSLCAVKTQDGPKPI 40 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 41,958,869 Number of Sequences: 219361 Number of extensions: 600553 Number of successful extensions: 1873 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1851 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1873 length of database: 80,573,946 effective HSP length: 93 effective length of database: 60,173,373 effective search space used: 1444160952 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)