| Clone Name | rbaet08h02 |
|---|---|
| Clone Library Name | barley_pub |
>PIP26_ORYSA (Q7XLR1) Probable aquaporin PIP2.6 (Plasma membrane intrinsic| protein 2.6) (OsPIP2.6) Length = 282 Score = 46.2 bits (108), Expect = 4e-05 Identities = 22/23 (95%), Positives = 23/23 (100%) Frame = -3 Query: 442 VGALAAAAYHQYILRAAAIKALG 374 +GALAAAAYHQYILRAAAIKALG Sbjct: 252 IGALAAAAYHQYILRAAAIKALG 274
>PIP1_ATRCA (P42767) Aquaporin PIP-type| Length = 282 Score = 46.2 bits (108), Expect = 4e-05 Identities = 22/23 (95%), Positives = 23/23 (100%) Frame = -3 Query: 442 VGALAAAAYHQYILRAAAIKALG 374 VGALAAAAYHQY+LRAAAIKALG Sbjct: 252 VGALAAAAYHQYVLRAAAIKALG 274
>PIP28_ARATH (Q9ZVX8) Probable aquaporin PIP2.8 (Plasma membrane intrinsic| protein 3b) (PIP3b) Length = 278 Score = 44.3 bits (103), Expect = 1e-04 Identities = 22/22 (100%), Positives = 22/22 (100%) Frame = -3 Query: 442 VGALAAAAYHQYILRAAAIKAL 377 VGALAAAAYHQYILRAAAIKAL Sbjct: 248 VGALAAAAYHQYILRAAAIKAL 269
>PIP27_ARATH (P93004) Aquaporin PIP2.7 (Plasma membrane intrinsic protein 3)| (Salt stress-induced major intrinsic protein) Length = 280 Score = 44.3 bits (103), Expect = 1e-04 Identities = 21/23 (91%), Positives = 23/23 (100%) Frame = -3 Query: 442 VGALAAAAYHQYILRAAAIKALG 374 +GALAAAAYHQYILRA+AIKALG Sbjct: 250 LGALAAAAYHQYILRASAIKALG 272
>PIP24_ARATH (Q9FF53) Probable aquaporin PIP2.4 (Plasma membrane intrinsic| protein 2.4) Length = 291 Score = 40.4 bits (93), Expect = 0.002 Identities = 19/23 (82%), Positives = 21/23 (91%) Frame = -3 Query: 442 VGALAAAAYHQYILRAAAIKALG 374 +GA AAA YHQ+ILRAAAIKALG Sbjct: 257 IGAAAAAFYHQFILRAAAIKALG 279
>PIP21_ORYSA (Q8H5N9) Probable aquaporin PIP2.1 (Plasma membrane intrinsic| protein 2a) (PIP2a) (OsPIP2.1) Length = 290 Score = 38.9 bits (89), Expect = 0.006 Identities = 19/23 (82%), Positives = 19/23 (82%) Frame = -3 Query: 442 VGALAAAAYHQYILRAAAIKALG 374 VGA AA YHQYILRA AIKALG Sbjct: 262 VGAAIAAFYHQYILRAGAIKALG 284
>PIP25_ARATH (Q9SV31) Probable aquaporin PIP2.5 (Plasma membrane intrinsic| protein 2d) (PIP2d) Length = 286 Score = 35.4 bits (80), Expect = 0.063 Identities = 16/22 (72%), Positives = 18/22 (81%) Frame = -3 Query: 439 GALAAAAYHQYILRAAAIKALG 374 GA AA YHQ++LRA AIKALG Sbjct: 257 GAAIAAFYHQFVLRAGAIKALG 278
>PIP26_ARATH (Q9ZV07) Probable aquaporin PIP2.6 (Plasma membrane intrinsic| protein 2e) (PIP2e) Length = 289 Score = 33.9 bits (76), Expect = 0.18 Identities = 15/23 (65%), Positives = 18/23 (78%) Frame = -3 Query: 442 VGALAAAAYHQYILRAAAIKALG 374 VGA AA YHQ++LRA A+KA G Sbjct: 256 VGAAIAAFYHQFVLRAGAMKAYG 278
>PIP22_ORYSA (Q6K215) Probable aquaporin PIP2.2 (Plasma membrane intrinsic| protein 2.2) (OsPIP2.2) Length = 288 Score = 33.5 bits (75), Expect = 0.24 Identities = 14/20 (70%), Positives = 17/20 (85%) Frame = -3 Query: 442 VGALAAAAYHQYILRAAAIK 383 +GA AAAYHQY+LRA+A K Sbjct: 261 IGAAIAAAYHQYVLRASAAK 280
>PIP23_ORYSA (Q7XUA6) Probable aquaporin PIP2.3 (Plasma membrane intrinsic| protein 2.3) (OsPIP2.3) Length = 290 Score = 33.5 bits (75), Expect = 0.24 Identities = 14/20 (70%), Positives = 17/20 (85%) Frame = -3 Query: 442 VGALAAAAYHQYILRAAAIK 383 +GA AAAYHQY+LRA+A K Sbjct: 262 IGAAIAAAYHQYVLRASAAK 281
>PIP23_ARATH (P30302) Aquaporin PIP2.3 (Plasma membrane intrinsic protein 2c)| (PIP2c) (TMP2C) (RD28-PIP) (Water stress-induced tonoplast intrinsic protein) (WSI-TIP) Length = 285 Score = 32.0 bits (71), Expect = 0.70 Identities = 13/23 (56%), Positives = 18/23 (78%) Frame = -3 Query: 442 VGALAAAAYHQYILRAAAIKALG 374 +GA AA YHQ++LRA+ K+LG Sbjct: 255 IGATIAAFYHQFVLRASGSKSLG 277
>PIP22_ARATH (P43287) Aquaporin PIP2.2 (Plasma membrane intrinsic protein 2b)| (PIP2b) (TMP2b) Length = 285 Score = 32.0 bits (71), Expect = 0.70 Identities = 13/23 (56%), Positives = 18/23 (78%) Frame = -3 Query: 442 VGALAAAAYHQYILRAAAIKALG 374 +GA AA YHQ++LRA+ K+LG Sbjct: 255 IGAAIAAFYHQFVLRASGSKSLG 277
>PIP21_ARATH (P43286) Aquaporin PIP2.1 (Plasma membrane intrinsic protein 2a)| (PIP2a) Length = 287 Score = 32.0 bits (71), Expect = 0.70 Identities = 13/23 (56%), Positives = 18/23 (78%) Frame = -3 Query: 442 VGALAAAAYHQYILRAAAIKALG 374 +GA AA YHQ++LRA+ K+LG Sbjct: 257 IGAAIAAFYHQFVLRASGSKSLG 279
>SMYD4_PONPY (Q5R5X9) SET and MYND domain-containing protein 4| Length = 804 Score = 30.8 bits (68), Expect = 1.6 Identities = 10/19 (52%), Positives = 12/19 (63%) Frame = +1 Query: 310 YCHRCIKLLAGVLSCSGCS 366 YCHRC+K + C GCS Sbjct: 295 YCHRCLKHTLATVPCDGCS 313
>SMYD4_HUMAN (Q8IYR2) SET and MYND domain-containing protein 4| Length = 804 Score = 30.8 bits (68), Expect = 1.6 Identities = 10/19 (52%), Positives = 12/19 (63%) Frame = +1 Query: 310 YCHRCIKLLAGVLSCSGCS 366 YCHRC+K + C GCS Sbjct: 295 YCHRCLKHTLATVPCDGCS 313
>SMYD4_CHICK (Q5F3V0) SET and MYND domain-containing protein 4| Length = 742 Score = 30.4 bits (67), Expect = 2.0 Identities = 10/19 (52%), Positives = 12/19 (63%) Frame = +1 Query: 310 YCHRCIKLLAGVLSCSGCS 366 YCH C+K L + C GCS Sbjct: 294 YCHHCLKQLLASIPCCGCS 312
>PIP28_ORYSA (Q7Y1E6) Probable aquaporin PIP2.8 (Plasma membrane intrinsic| protein 2.8) (OsPIP2.8) Length = 280 Score = 30.0 bits (66), Expect = 2.7 Identities = 14/20 (70%), Positives = 14/20 (70%) Frame = -3 Query: 439 GALAAAAYHQYILRAAAIKA 380 GA AA YH YILR AA KA Sbjct: 250 GAAAAMIYHHYILRGAAAKA 269
>PIP27_ORYSA (Q651D5) Probable aquaporin PIP2.7 (Plasma membrane intrinsic| protein 2.7) (OsPIP2.7) Length = 290 Score = 30.0 bits (66), Expect = 2.7 Identities = 13/22 (59%), Positives = 16/22 (72%) Frame = -3 Query: 442 VGALAAAAYHQYILRAAAIKAL 377 +GA AAAYH+ +LR A KAL Sbjct: 259 IGAFLAAAYHKLVLRGEAAKAL 280
>UBR1_CAEEL (P91133) Ubiquitin-protein ligase E3 component N-recognin (EC| 6.-.-.-) (Ubiquitin-protein ligase E3-alpha) Length = 1927 Score = 29.6 bits (65), Expect = 3.5 Identities = 16/49 (32%), Positives = 22/49 (44%) Frame = -2 Query: 368 PEQPEQLSTPANNLMQRWQYCSSCPSGAS*PHKRTGFVLAVLLLHRAHP 222 P +P+ TP + L+ S P+ A PH T F V L + A P Sbjct: 1560 PPRPKLAQTPGSPLLSAPSTSSFTPAPAQIPHSGTNFAFLVQLFNPAGP 1608
>CATA_BACST (P14412) Peroxidase/catalase (EC 1.11.1.6) (Catalase-peroxidase)| Length = 735 Score = 28.9 bits (63), Expect = 5.9 Identities = 9/22 (40%), Positives = 15/22 (68%) Frame = +2 Query: 170 WWPLSLSLTCMHRH*TRPDGHD 235 WWP L+L+ +H+H + + HD Sbjct: 31 WWPNQLNLSILHQHDRKTNPHD 52
>SMYD4_MOUSE (Q8BTK5) SET and MYND domain-containing protein 4| Length = 799 Score = 28.5 bits (62), Expect = 7.7 Identities = 9/19 (47%), Positives = 11/19 (57%) Frame = +1 Query: 310 YCHRCIKLLAGVLSCSGCS 366 YCHRC+K + C CS Sbjct: 295 YCHRCLKHTLATVPCGSCS 313
>TELT_MOUSE (O70548) Telethonin (Titin cap protein)| Length = 167 Score = 28.5 bits (62), Expect = 7.7 Identities = 13/39 (33%), Positives = 17/39 (43%) Frame = +1 Query: 205 QTLNEAGWARWRSSTANTKPVRLCG*LAPDGHEEQYCHR 321 Q EA WA W+ T +T+P C D + HR Sbjct: 15 QERREAFWAEWKDLTLSTRPEEGCSLHEEDTQRHETYHR 53 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 56,066,315 Number of Sequences: 219361 Number of extensions: 1039346 Number of successful extensions: 2648 Number of sequences better than 10.0: 22 Number of HSP's better than 10.0 without gapping: 2573 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2647 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2618960580 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)