| Clone Name | rbaet08d11 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | YME3_YEAST (Q04712) Hypothetical 59.3 kDa protein in PRP39-CAT2 ... | 28 | 6.4 | 2 | ADA15_HUMAN (Q13444) ADAM 15 precursor (EC 3.4.24.-) (A disinteg... | 28 | 8.3 | 3 | CARD4_MOUSE (Q8BHB0) Caspase recruitment domain-containing prote... | 28 | 8.3 |
|---|
>YME3_YEAST (Q04712) Hypothetical 59.3 kDa protein in PRP39-CAT2 intergenic| region Length = 507 Score = 28.5 bits (62), Expect = 6.4 Identities = 21/81 (25%), Positives = 36/81 (44%) Frame = +2 Query: 2 SSVHWISSKFRLTNSDVLCDNFFDSFQQLNLIALNPLSNFAQIAMCPRYLRRFLLRMLDK 181 + V +I + L +D L F + + +LI L+ Q+ Y+R FL LDK Sbjct: 362 AEVWFIYASCHLLKADTLSRQFVNDNKNNDLIGLDRDIKINQVIKHIHYVRTFLKICLDK 421 Query: 182 QFAALTSYKLQNKSWKFSEMI 244 A+ S ++N+ F + Sbjct: 422 GGFAVPSRLIENQLKSFESRL 442
>ADA15_HUMAN (Q13444) ADAM 15 precursor (EC 3.4.24.-) (A disintegrin and| metalloproteinase domain 15) (Metalloproteinase-like, disintegrin-like, and cysteine-rich protein 15) (MDC-15) (Metalloprotease RGD disintegrin protein) (Metargidin) Length = 814 Score = 28.1 bits (61), Expect = 8.3 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = +1 Query: 286 HCQGEACESSWRESKSTTPSRTFQRPPESP 375 H G C SWRES T Q PPE P Sbjct: 173 HLPGHTCALSWRESVHT------QTPPEHP 196
>CARD4_MOUSE (Q8BHB0) Caspase recruitment domain-containing protein 4| Length = 953 Score = 28.1 bits (61), Expect = 8.3 Identities = 15/34 (44%), Positives = 18/34 (52%) Frame = -2 Query: 141 GHIAICAKLDNGFRAMRFSCWKESKKLSQRTSLF 40 G + AK FR FSC+KES LS + LF Sbjct: 222 GRLTSTAKFFFHFRCRMFSCFKESDMLSLQDLLF 255 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 51,604,786 Number of Sequences: 219361 Number of extensions: 839640 Number of successful extensions: 2562 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 2518 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2560 length of database: 80,573,946 effective HSP length: 100 effective length of database: 58,637,846 effective search space used: 2169600302 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)