| Clone Name | rbaet08d07 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | GLTT_BACCA (P24944) Proton/sodium-glutamate symport protein (Glu... | 28 | 7.5 | 2 | TIMD2_MOUSE (Q8R183) T-cell immunoglobulin and mucin domain-cont... | 27 | 9.8 | 3 | SYC_BUCAI (P57558) Cysteinyl-tRNA synthetase (EC 6.1.1.16) (Cyst... | 27 | 9.8 |
|---|
>GLTT_BACCA (P24944) Proton/sodium-glutamate symport protein| (Glutamate-aspartate carrier protein) Length = 421 Score = 27.7 bits (60), Expect = 7.5 Identities = 14/50 (28%), Positives = 25/50 (50%) Frame = -1 Query: 257 TSDHISHFVSSQTFMAVVPANLTXXXXXFTGTNASVVFFDVIKSDGNACL 108 T++ + H +TF+ +VP N+ TG ++FF V+ G A + Sbjct: 121 TTNEVQHHSMVETFVNIVPKNI--FESLSTGDMLPIIFFSVMFGLGVAAI 168
>TIMD2_MOUSE (Q8R183) T-cell immunoglobulin and mucin domain-containing protein| 2 precursor (TIMD-2) (T cell membrane protein 2) (TIM-2) Length = 305 Score = 27.3 bits (59), Expect = 9.8 Identities = 17/56 (30%), Positives = 27/56 (48%), Gaps = 7/56 (12%) Frame = +1 Query: 97 VGLLKHALPSLFITSKKTTDAFVPVKKKKKNVRFA-------GTTAMKVCEETKCE 243 VG+ AL L + S +V +K+K +++ F G + KV E T+CE Sbjct: 234 VGISIAALLILMLLSTMVITRYVVMKRKSESLSFVAFPISKIGASPKKVVERTRCE 289
>SYC_BUCAI (P57558) Cysteinyl-tRNA synthetase (EC 6.1.1.16) (Cysteine--tRNA| ligase) (CysRS) Length = 464 Score = 27.3 bits (59), Expect = 9.8 Identities = 11/33 (33%), Positives = 16/33 (48%) Frame = +1 Query: 127 LFITSKKTTDAFVPVKKKKKNVRFAGTTAMKVC 225 +F T T + F P+KK + N+ G T C Sbjct: 4 IFNTLTSTKEIFTPIKKNRVNLYVCGVTVYDFC 36 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 44,432,687 Number of Sequences: 219361 Number of extensions: 755044 Number of successful extensions: 1493 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1479 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1493 length of database: 80,573,946 effective HSP length: 84 effective length of database: 62,147,622 effective search space used: 1491542928 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)