| Clone Name | rbaet08b04 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | MTR_NEUCR (P38680) N amino acid transport system protein (Methyl... | 36 | 0.049 | 2 | UNC47_CAEEL (P34579) Vesicular GABA transporter (Uncoordinated p... | 28 | 7.7 | 3 | LIAF_BACSU (O32199) Protein liaF | 28 | 7.7 |
|---|
>MTR_NEUCR (P38680) N amino acid transport system protein (Methyltryptophan| resistance protein) Length = 470 Score = 35.8 bits (81), Expect = 0.049 Identities = 17/52 (32%), Positives = 32/52 (61%), Gaps = 2/52 (3%) Frame = -2 Query: 422 IVSTVLAISLPFFNDILGLLGALGFWPLTVYFPVEMY--ISQSKMKKYSRKW 273 +++ V+A ++PFF+D+L + AL + YFP MY I+++ K +K+ Sbjct: 372 LIAWVIAEAIPFFSDLLAICSALFISGFSFYFPALMYFKITRNDAKSQGKKY 423
>UNC47_CAEEL (P34579) Vesicular GABA transporter (Uncoordinated protein 47)| (Protein unc-47) Length = 486 Score = 28.5 bits (62), Expect = 7.7 Identities = 12/57 (21%), Positives = 32/57 (56%), Gaps = 2/57 (3%) Frame = -2 Query: 437 RTAFVIVSTVLAISLPFFNDILGLLGALGFWPLTVYFPV--EMYISQSKMKKYSRKW 273 R V+ + +A+S+P+ +++GL+G + L+ +P +YI + + + +++ Sbjct: 398 RIILVLFTLFVALSVPYLVELMGLVGNITGTMLSFIWPALFHLYIKEKTLNNFEKRF 454
>LIAF_BACSU (O32199) Protein liaF| Length = 241 Score = 28.5 bits (62), Expect = 7.7 Identities = 17/47 (36%), Positives = 25/47 (53%) Frame = -2 Query: 410 VLAISLPFFNDILGLLGALGFWPLTVYFPVEMYISQSKMKKYSRKWV 270 + + F I+G+ G L FWPL +F + Y +KKYSR W+ Sbjct: 11 IALFGISMFLQIIGI-GDLLFWPL--FFLIAGYF----LKKYSRDWL 50 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 46,768,956 Number of Sequences: 219361 Number of extensions: 699511 Number of successful extensions: 1713 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1688 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1713 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2628831825 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)