| Clone Name | rbaet07f06 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | SCNNH_XENLA (O13263) Amiloride-sensitive sodium channel gamma-2-... | 32 | 0.55 | 2 | HERC2_MOUSE (Q4U2R1) HECT domain and RCC1-like domain-containing... | 31 | 0.94 | 3 | HERC2_HUMAN (O95714) HECT domain and RCC1-like domain-containing... | 31 | 0.94 | 4 | ATXR3_ARATH (O23372) Probable histone-lysine N-methyltransferase... | 28 | 8.0 |
|---|
>SCNNH_XENLA (O13263) Amiloride-sensitive sodium channel gamma-2-subunit| (Epithelial Na(+) channel gamma-2 subunit) (Gamma-2 ENAC) (Nonvoltage-gated sodium channel 1 gamma-2 subunit) (SCNEG2) (Gamma-2 NACH) Length = 663 Score = 31.6 bits (70), Expect = 0.55 Identities = 14/42 (33%), Positives = 24/42 (57%) Frame = +3 Query: 15 NMPHYYFCSINNFNTCTRWTIGKGISANLEHGNVYYS*V*AR 140 NM + C NN + CT +T G G++A E ++Y+ + A+ Sbjct: 202 NMVGFKLCDANNSSDCTIFTFGSGVNAIQEWYRLHYNNILAK 243
>HERC2_MOUSE (Q4U2R1) HECT domain and RCC1-like domain-containing protein 2| Length = 4836 Score = 30.8 bits (68), Expect = 0.94 Identities = 10/14 (71%), Positives = 12/14 (85%) Frame = -3 Query: 254 RWGDRDAPPPGLAR 213 +WGD+D PPPGL R Sbjct: 1881 KWGDQDGPPPGLGR 1894
>HERC2_HUMAN (O95714) HECT domain and RCC1-like domain-containing protein 2| Length = 4834 Score = 30.8 bits (68), Expect = 0.94 Identities = 10/14 (71%), Positives = 12/14 (85%) Frame = -3 Query: 254 RWGDRDAPPPGLAR 213 +WGD+D PPPGL R Sbjct: 1880 KWGDQDGPPPGLGR 1893
>ATXR3_ARATH (O23372) Probable histone-lysine N-methyltransferase ATXR3 (EC| 2.1.1.43) (Trithorax-related protein 3) (TRX-related protein 3) (Protein SET DOMAIN GROUP 2) Length = 2351 Score = 27.7 bits (60), Expect = 8.0 Identities = 18/68 (26%), Positives = 32/68 (47%), Gaps = 4/68 (5%) Frame = +1 Query: 76 SERAFQQTWSTATFIIHKYRRERTPTSQHARALAFKHAHI---RPWRP-CRASPGGGASR 243 +ER ++ ++ + + KY R+ S A+A + KH H W P R+ R Sbjct: 348 AERLYRDSYPSKNSSLEKYPRKHQDASFPAKAFSDKHGHSPSRSDWSPHDRSRYHENRDR 407 Query: 244 SPQRKKRT 267 SP ++R+ Sbjct: 408 SPYARERS 415 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 38,953,147 Number of Sequences: 219361 Number of extensions: 685692 Number of successful extensions: 1610 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1585 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1610 length of database: 80,573,946 effective HSP length: 65 effective length of database: 66,315,481 effective search space used: 1591571544 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)