| Clone Name | rbaet06h08 |
|---|---|
| Clone Library Name | barley_pub |
>MDM2_BRARE (O42354) Ubiquitin-protein ligase E3 Mdm2 (EC 6.3.2.-) (p53-binding| protein Mdm2) (Double minute 2 protein) Length = 445 Score = 28.5 bits (62), Expect = 4.4 Identities = 15/45 (33%), Positives = 20/45 (44%) Frame = -1 Query: 266 TCIHPLEVCVLADARGCLYPSTYVRTCHFSNYYCCFGCATKKKTR 132 TC+ P +C GC+ + RT H C+ CA K K R Sbjct: 387 TCLEPCVICQSRPKNGCI---VHGRTGHL---MACYTCAKKLKNR 425
>RINI_MOUSE (Q91VI7) Ribonuclease inhibitor (Ribonuclease/angiogenin inhibitor| 1) Length = 456 Score = 28.5 bits (62), Expect = 4.4 Identities = 17/53 (32%), Positives = 25/53 (47%) Frame = -1 Query: 221 GCLYPSTYVRTCHFSNYYCCFGCATKKKTRTS*RCELQKHSVILSVPTVYSLC 63 GC S +++TC + C + C+ K+R+ ELQ S L V LC Sbjct: 307 GCQLESLWIKTCSLTAASCPYFCSVLTKSRS--LLELQMSSNPLGDEGVQELC 357
>ETFA_PONPY (Q5RC31) Electron transfer flavoprotein alpha-subunit,| mitochondrial precursor (Alpha-ETF) Length = 333 Score = 28.1 bits (61), Expect = 5.7 Identities = 14/38 (36%), Positives = 18/38 (47%) Frame = -1 Query: 251 LEVCVLADARGCLYPSTYVRTCHFSNYYCCFGCATKKK 138 LEV ++D P T+VRT + N C C K K Sbjct: 127 LEVAPISDIIAIKSPDTFVRTIYAGNALCTVKCDEKVK 164
>ETFA_MACFA (Q8HXY0) Electron transfer flavoprotein alpha-subunit,| mitochondrial precursor (Alpha-ETF) Length = 333 Score = 28.1 bits (61), Expect = 5.7 Identities = 14/38 (36%), Positives = 18/38 (47%) Frame = -1 Query: 251 LEVCVLADARGCLYPSTYVRTCHFSNYYCCFGCATKKK 138 LEV ++D P T+VRT + N C C K K Sbjct: 127 LEVAPISDIIAIKSPDTFVRTIYAGNALCTVKCDEKVK 164
>ETFA_HUMAN (P13804) Electron transfer flavoprotein alpha-subunit,| mitochondrial precursor (Alpha-ETF) Length = 333 Score = 28.1 bits (61), Expect = 5.7 Identities = 14/38 (36%), Positives = 18/38 (47%) Frame = -1 Query: 251 LEVCVLADARGCLYPSTYVRTCHFSNYYCCFGCATKKK 138 LEV ++D P T+VRT + N C C K K Sbjct: 127 LEVAPISDIIAIKSPDTFVRTIYAGNALCTVKCDEKVK 164
>RBS_CHLMO (P17537) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 168 Score = 27.7 bits (60), Expect = 7.5 Identities = 17/64 (26%), Positives = 27/64 (42%), Gaps = 2/64 (3%) Frame = -1 Query: 281 QLQEWTCIHPLEVCVLADARGCLYPSTYVRTCHFSN--YYCCFGCATKKKTRTS*RCELQ 108 +L + C P +V A +P+ Y+R F N C G ++ + C L+ Sbjct: 105 KLPMFGCTDPSQVLREVSACQVAFPNVYIRLVAFDNVKQVQCMGFLVQRPRNAAEYCPLE 164 Query: 107 KHSV 96 K SV Sbjct: 165 KRSV 168
>RPOC2_PSEAK (Q3ZJ90) DNA-directed RNA polymerase beta'' chain (EC 2.7.7.6) (PEP)| (Plastid-encoded RNA polymerase beta'' subunit) (RNA polymerase beta'' subunit) Length = 3462 Score = 27.3 bits (59), Expect = 9.8 Identities = 11/21 (52%), Positives = 15/21 (71%) Frame = -2 Query: 76 CIAFVFELCVYMDRKLGENLP 14 C +FVF+ Y+ +KL ENLP Sbjct: 1232 CRSFVFQTKFYLSKKLFENLP 1252
>RECF_RHIME (P56903) DNA replication and repair protein recF| Length = 374 Score = 27.3 bits (59), Expect = 9.8 Identities = 14/33 (42%), Positives = 17/33 (51%) Frame = +2 Query: 182 NGTYVRTY*GTNTHVHQLAHTPPMDGCMSTPAA 280 NGT RT H+ L TP MDG + P+A Sbjct: 106 NGTAARTVDELTDHLRVLWLTPAMDGLFTGPSA 138
>YAJB_SCHPO (Q09910) Hypothetical protein C30D11.11 in chromosome I| Length = 442 Score = 27.3 bits (59), Expect = 9.8 Identities = 13/37 (35%), Positives = 22/37 (59%) Frame = +1 Query: 124 QLVRVFFLVAHPKQQ**LLKWHVRTYVLGYKHPRASA 234 ++VR+FFL++ K + WH + + YKH R +A Sbjct: 243 RIVRIFFLLSAMKCLGCSVIWHTFSSLSNYKHMRCAA 279 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 52,898,432 Number of Sequences: 219361 Number of extensions: 1006031 Number of successful extensions: 2581 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 2474 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2578 length of database: 80,573,946 effective HSP length: 85 effective length of database: 61,928,261 effective search space used: 1486278264 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)