| Clone Name | rbaet06d02 |
|---|---|
| Clone Library Name | barley_pub |
>RMT2_ASPFU (Q4X1R1) Arginine N-methyltransferase 2 (EC 2.1.1.-)| Length = 424 Score = 30.0 bits (66), Expect = 1.6 Identities = 14/46 (30%), Positives = 27/46 (58%), Gaps = 2/46 (4%) Frame = +3 Query: 3 QINSSQTEPKMFIQP--QTPKPISVQWTLWSIIQLNNQTPWC*TRQ 134 + +S+ TE K +Q +T K + + +W+ + LN++TP C R+ Sbjct: 79 ETSSASTEQKSLVQSAAETVKYLLQEGAIWNDLDLNDETPGCIARR 124
>YHV5_YEAST (P38851) Hypothetical 143.6 kDa protein in SPO16-REC104 intergenic| region Length = 1228 Score = 29.3 bits (64), Expect = 2.7 Identities = 17/40 (42%), Positives = 22/40 (55%) Frame = +1 Query: 16 AKQNQKCSYSLKRQNQFQFNGHYGRSYNSIIKLLGAKQDN 135 AK++ C + L R+ QFQ N R+ N I LL K DN Sbjct: 826 AKEDASCQFELCRKLQFQLN----RTSNFIKDLLWLKDDN 861
>ZYGBL_MOUSE (Q80ZJ6) Zyg-11 protein homolog (Zyg-11 homolog B-like)| Length = 779 Score = 27.7 bits (60), Expect = 7.9 Identities = 12/37 (32%), Positives = 18/37 (48%) Frame = +3 Query: 6 INSSQTEPKMFIQPQTPKPISVQWTLWSIIQLNNQTP 116 IN EP + + PQ P+S W W++ L + P Sbjct: 691 INYRSFEPILRLLPQGISPVSQHWATWALYNLVSVYP 727
>ZYGBL_PONPY (Q5RAG3) Zyg-11 protein homolog (Zyg-11 homolog B-like)| Length = 766 Score = 27.7 bits (60), Expect = 7.9 Identities = 12/37 (32%), Positives = 18/37 (48%) Frame = +3 Query: 6 INSSQTEPKMFIQPQTPKPISVQWTLWSIIQLNNQTP 116 IN EP + + PQ P+S W W++ L + P Sbjct: 678 INYRSFEPILRLLPQGISPVSQHWATWALYNLVSVYP 714
>ZYGBL_HUMAN (Q7Z7L7) Zyg-11 protein homolog (Zyg-11 homolog B-like)| Length = 766 Score = 27.7 bits (60), Expect = 7.9 Identities = 12/37 (32%), Positives = 18/37 (48%) Frame = +3 Query: 6 INSSQTEPKMFIQPQTPKPISVQWTLWSIIQLNNQTP 116 IN EP + + PQ P+S W W++ L + P Sbjct: 678 INYRSFEPILRLLPQGISPVSQHWATWALYNLVSVYP 714
>RMT2_EMENI (Q5B058) Arginine N-methyltransferase 2 (EC 2.1.1.-)| Length = 426 Score = 27.7 bits (60), Expect = 7.9 Identities = 11/29 (37%), Positives = 18/29 (62%) Frame = +3 Query: 48 QTPKPISVQWTLWSIIQLNNQTPWC*TRQ 134 QT K + + +W+ + LNN+TP C R+ Sbjct: 95 QTVKLLLQEGAIWNDLDLNNETPGCIARR 123 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 37,180,085 Number of Sequences: 219361 Number of extensions: 578050 Number of successful extensions: 1333 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 1319 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1333 length of database: 80,573,946 effective HSP length: 69 effective length of database: 65,438,037 effective search space used: 1570512888 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)