| Clone Name | rbaet06d01 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | TUSD_PASMU (Q9CL89) Sulfurtransferase tusD homolog (EC 2.8.1.-) | 30 | 2.1 | 2 | SPHS_SYNP7 (P39664) Sensor protein sphS (EC 2.7.13.3) | 28 | 4.7 | 3 | NMDE4_RAT (Q62645) Glutamate [NMDA] receptor subunit epsilon 4 p... | 28 | 6.2 |
|---|
>TUSD_PASMU (Q9CL89) Sulfurtransferase tusD homolog (EC 2.8.1.-)| Length = 126 Score = 29.6 bits (65), Expect = 2.1 Identities = 14/25 (56%), Positives = 17/25 (68%) Frame = -1 Query: 192 WLRPASDEYFQRHHEQRRAPDRHVP 118 +L PASDE+ +H QR A D HVP Sbjct: 50 FLYPASDEFNLQHAWQRLAQDYHVP 74
>SPHS_SYNP7 (P39664) Sensor protein sphS (EC 2.7.13.3)| Length = 413 Score = 28.5 bits (62), Expect = 4.7 Identities = 14/32 (43%), Positives = 18/32 (56%) Frame = +3 Query: 150 RGGVESIRPKQAVASSPAEGAGAADNRQLPDA 245 RG +RP A +SSP G G A RQ+ +A Sbjct: 341 RGDPSRVRPAAASSSSPGSGLGLAIARQVVEA 372
>NMDE4_RAT (Q62645) Glutamate [NMDA] receptor subunit epsilon 4 precursor| (N-methyl D-aspartate receptor subtype 2D) (NR2D) (NMDAR2D) Length = 1323 Score = 28.1 bits (61), Expect = 6.2 Identities = 20/59 (33%), Positives = 26/59 (44%), Gaps = 1/59 (1%) Frame = -1 Query: 252 PRQRQGAAGCRR-HRRLPRGCWLRPASDEYFQRHHEQRRAPDRHVPKRVGAARSYVDLS 79 P +R+ GC R H PR PA+ + RH +R A P +RS DLS Sbjct: 1207 PPRRRARCGCPRPHPHRPRASHRAPAAAPHHHRH--RRAAGGWDFPPPAPTSRSLEDLS 1263 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 31,128,502 Number of Sequences: 219361 Number of extensions: 478860 Number of successful extensions: 1749 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1701 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1748 length of database: 80,573,946 effective HSP length: 63 effective length of database: 66,754,203 effective search space used: 1602100872 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)