| Clone Name | rbaet06c10 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | LEU2_NITWN (Q3SNV3) 3-isopropylmalate dehydratase large subunit ... | 28 | 5.8 | 2 | TEGU_SHV21 (Q01056) Probable large tegument protein | 28 | 5.8 | 3 | QUEA_PELLD (Q3B5E2) S-adenosylmethionine:tRNA ribosyltransferase... | 28 | 7.5 | 4 | HNF3A_RAT (P23512) Hepatocyte nuclear factor 3-alpha (HNF-3A) (F... | 28 | 7.5 |
|---|
>LEU2_NITWN (Q3SNV3) 3-isopropylmalate dehydratase large subunit (EC 4.2.1.33)| (Isopropylmalate isomerase) (Alpha-IPM isomerase) (IPMI) Length = 468 Score = 28.1 bits (61), Expect = 5.8 Identities = 11/28 (39%), Positives = 19/28 (67%) Frame = +2 Query: 230 LFVGTSTAGRLIDVRPCSNLGE*KLVNG 313 +F+G+ T GR+ D+R + + E + VNG Sbjct: 344 VFIGSCTNGRIEDLRAAAKIAEGRTVNG 371
>TEGU_SHV21 (Q01056) Probable large tegument protein| Length = 2469 Score = 28.1 bits (61), Expect = 5.8 Identities = 12/36 (33%), Positives = 18/36 (50%) Frame = -2 Query: 276 GLTSMSRPAVEVPTKSYEQKLDRQYYGPISPLEIYS 169 G T + +E P S L++QY P LE++S Sbjct: 1947 GTTEPFKTMIEAPKSSLSTNLNKQYVSPPHELEVFS 1982
>QUEA_PELLD (Q3B5E2) S-adenosylmethionine:tRNA ribosyltransferase-isomerase (EC| 5.-.-.-) (Queuosine biosynthesis protein queA) Length = 341 Score = 27.7 bits (60), Expect = 7.5 Identities = 12/38 (31%), Positives = 23/38 (60%) Frame = -2 Query: 315 APLTNFHSPRLLHGLTSMSRPAVEVPTKSYEQKLDRQY 202 A LTNFH+PR + + + ++ ++Y + LD++Y Sbjct: 292 ALLTNFHAPRSTVLMLTAAFAGPDLLRRAYREALDKEY 329
>HNF3A_RAT (P23512) Hepatocyte nuclear factor 3-alpha (HNF-3A) (Forkhead box| protein A1) Length = 466 Score = 27.7 bits (60), Expect = 7.5 Identities = 15/47 (31%), Positives = 23/47 (48%) Frame = -2 Query: 315 APLTNFHSPRLLHGLTSMSRPAVEVPTKSYEQKLDRQYYGPISPLEI 175 AP +F+ P ++ L S S ++ K+YEQ L YG P + Sbjct: 385 APHYSFNHPFSINNLMSSSEQQHKLDFKAYEQALQYSPYGATLPASL 431 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 42,124,325 Number of Sequences: 219361 Number of extensions: 685834 Number of successful extensions: 1691 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1673 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1691 length of database: 80,573,946 effective HSP length: 82 effective length of database: 62,586,344 effective search space used: 1502072256 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)