ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | rbaet04b12 |
|---|---|
| Clone Library Name | barley_pub |
>SAHH2_ARATH (Q9LK36) Adenosylhomocysteinase 2 (EC 3.3.1.1)| (S-adenosyl-L-homocysteine hydrolase 1) (SAH hydrolase 2) (AdoHcyase 2) Length = 485 Score = 50.8 bits (120), Expect = 8e-07 Identities = 23/28 (82%), Positives = 25/28 (89%) Frame = -3 Query: 356 ARLTKLTKAQSEYISIPVEGPYKPSAYR 273 ARLTKLTK QS+Y+SIPVEGPYKP YR Sbjct: 457 ARLTKLTKDQSDYVSIPVEGPYKPVHYR 484
>SAHH_PROMM (Q7V926) Adenosylhomocysteinase (EC 3.3.1.1)| (S-adenosyl-L-homocysteine hydrolase) (AdoHcyase) Length = 476 Score = 49.3 bits (116), Expect = 2e-06 Identities = 21/28 (75%), Positives = 25/28 (89%) Frame = -3 Query: 356 ARLTKLTKAQSEYISIPVEGPYKPSAYR 273 ARLT+LTK Q++YIS+PVEGPYKP YR Sbjct: 448 ARLTELTKQQADYISVPVEGPYKPDHYR 475
>SAHH_CATRO (P35007) Adenosylhomocysteinase (EC 3.3.1.1)| (S-adenosyl-L-homocysteine hydrolase) (AdoHcyase) Length = 485 Score = 49.3 bits (116), Expect = 2e-06 Identities = 20/28 (71%), Positives = 26/28 (92%) Frame = -3 Query: 356 ARLTKLTKAQSEYISIPVEGPYKPSAYR 273 A+LTKLTK Q++YIS+P+EGPYKP+ YR Sbjct: 457 AKLTKLTKDQADYISVPIEGPYKPAHYR 484
>SAHH1_ARATH (O23255) Adenosylhomocysteinase 1 (EC 3.3.1.1)| (S-adenosyl-L-homocysteine hydrolase 1) (SAH hydrolase 1) (AdoHcyase 1) (HOMOLOGY-DEPENDENT GENE SILENCING 1 protein) Length = 485 Score = 49.3 bits (116), Expect = 2e-06 Identities = 21/28 (75%), Positives = 25/28 (89%) Frame = -3 Query: 356 ARLTKLTKAQSEYISIPVEGPYKPSAYR 273 ARLTKL+K QS+Y+SIP+EGPYKP YR Sbjct: 457 ARLTKLSKDQSDYVSIPIEGPYKPPHYR 484
>SAHH_WHEAT (P32112) Adenosylhomocysteinase (EC 3.3.1.1)| (S-adenosyl-L-homocysteine hydrolase) (AdoHcyase) Length = 485 Score = 48.9 bits (115), Expect = 3e-06 Identities = 22/28 (78%), Positives = 25/28 (89%) Frame = -3 Query: 356 ARLTKLTKAQSEYISIPVEGPYKPSAYR 273 ARLTKLTK+QS+YISIP+EGPYK YR Sbjct: 457 ARLTKLTKSQSDYISIPIEGPYKLRLYR 484
>SAHH_PHASS (P50249) Adenosylhomocysteinase (EC 3.3.1.1)| (S-adenosyl-L-homocysteine hydrolase) (AdoHcyase) Length = 485 Score = 48.5 bits (114), Expect = 4e-06 Identities = 20/28 (71%), Positives = 26/28 (92%) Frame = -3 Query: 356 ARLTKLTKAQSEYISIPVEGPYKPSAYR 273 A+LTKLT +Q++YIS+PVEGPYKP+ YR Sbjct: 457 AKLTKLTPSQADYISVPVEGPYKPAHYR 484
>SAHH_TOBAC (P68173) Adenosylhomocysteinase (EC 3.3.1.1)| (S-adenosyl-L-homocysteine hydrolase) (AdoHcyase) (Cytokinin-binding protein CBP57) Length = 485 Score = 48.1 bits (113), Expect = 5e-06 Identities = 20/28 (71%), Positives = 26/28 (92%) Frame = -3 Query: 356 ARLTKLTKAQSEYISIPVEGPYKPSAYR 273 A+LTKL+K Q++YIS+PVEGPYKP+ YR Sbjct: 457 AKLTKLSKDQADYISVPVEGPYKPAHYR 484
>SAHH_PETCR (Q01781) Adenosylhomocysteinase (EC 3.3.1.1)| (S-adenosyl-L-homocysteine hydrolase) (AdoHcyase) Length = 485 Score = 48.1 bits (113), Expect = 5e-06 Identities = 20/28 (71%), Positives = 26/28 (92%) Frame = -3 Query: 356 ARLTKLTKAQSEYISIPVEGPYKPSAYR 273 A+LTKL+K Q++YIS+PVEGPYKP+ YR Sbjct: 457 AKLTKLSKDQADYISVPVEGPYKPAHYR 484
>SAHH_NICSY (P68172) Adenosylhomocysteinase (EC 3.3.1.1)| (S-adenosyl-L-homocysteine hydrolase) (AdoHcyase) (Cytokinin-binding protein CBP57) Length = 485 Score = 48.1 bits (113), Expect = 5e-06 Identities = 20/28 (71%), Positives = 26/28 (92%) Frame = -3 Query: 356 ARLTKLTKAQSEYISIPVEGPYKPSAYR 273 A+LTKL+K Q++YIS+PVEGPYKP+ YR Sbjct: 457 AKLTKLSKDQADYISVPVEGPYKPAHYR 484
>SAHH_MESCR (P93253) Adenosylhomocysteinase (EC 3.3.1.1)| (S-adenosyl-L-homocysteine hydrolase) (AdoHcyase) Length = 485 Score = 48.1 bits (113), Expect = 5e-06 Identities = 20/28 (71%), Positives = 26/28 (92%) Frame = -3 Query: 356 ARLTKLTKAQSEYISIPVEGPYKPSAYR 273 A+LTKL+K Q++YIS+PVEGPYKP+ YR Sbjct: 457 AKLTKLSKDQADYISVPVEGPYKPAHYR 484
>SAHH_MEDSA (P50246) Adenosylhomocysteinase (EC 3.3.1.1)| (S-adenosyl-L-homocysteine hydrolase) (AdoHcyase) Length = 485 Score = 48.1 bits (113), Expect = 5e-06 Identities = 20/28 (71%), Positives = 26/28 (92%) Frame = -3 Query: 356 ARLTKLTKAQSEYISIPVEGPYKPSAYR 273 A+LTKL+K Q++YIS+PVEGPYKP+ YR Sbjct: 457 AKLTKLSKDQADYISVPVEGPYKPAHYR 484
>SAHH_LYCES (Q9SWF5) Adenosylhomocysteinase (EC 3.3.1.1)| (S-adenosyl-L-homocysteine hydrolase) (AdoHcyase) Length = 485 Score = 47.4 bits (111), Expect = 9e-06 Identities = 20/28 (71%), Positives = 25/28 (89%) Frame = -3 Query: 356 ARLTKLTKAQSEYISIPVEGPYKPSAYR 273 A+LTKLTK Q++YI +PVEGPYKP+ YR Sbjct: 457 AKLTKLTKDQADYIYVPVEGPYKPAHYR 484
>SAHH_LUPLU (Q9SP37) Adenosylhomocysteinase (EC 3.3.1.1)| (S-adenosyl-L-homocysteine hydrolase) (AdoHcyase) Length = 485 Score = 47.0 bits (110), Expect = 1e-05 Identities = 20/28 (71%), Positives = 25/28 (89%) Frame = -3 Query: 356 ARLTKLTKAQSEYISIPVEGPYKPSAYR 273 A+LTKL+K Q++YIS+PVEGPYKP YR Sbjct: 457 AKLTKLSKDQADYISVPVEGPYKPFHYR 484
>SAHH_CHLTE (Q8KEG8) Adenosylhomocysteinase (EC 3.3.1.1)| (S-adenosyl-L-homocysteine hydrolase) (AdoHcyase) Length = 471 Score = 45.8 bits (107), Expect = 3e-05 Identities = 19/28 (67%), Positives = 23/28 (82%) Frame = -3 Query: 356 ARLTKLTKAQSEYISIPVEGPYKPSAYR 273 A+LT LTK Q++YI +PVEGPYKP YR Sbjct: 443 AKLTTLTKEQADYIGVPVEGPYKPEHYR 470
>SAHH_PROMP (Q7UZN3) Adenosylhomocysteinase (EC 3.3.1.1)| (S-adenosyl-L-homocysteine hydrolase) (AdoHcyase) Length = 472 Score = 45.4 bits (106), Expect = 3e-05 Identities = 19/28 (67%), Positives = 24/28 (85%) Frame = -3 Query: 356 ARLTKLTKAQSEYISIPVEGPYKPSAYR 273 A+LTKLTK Q++YI++ VEGPYKP YR Sbjct: 444 AKLTKLTKDQADYINVSVEGPYKPEQYR 471
>SAHH_RHOBA (Q7TTZ5) Adenosylhomocysteinase (EC 3.3.1.1)| (S-adenosyl-L-homocysteine hydrolase) (AdoHcyase) Length = 448 Score = 45.4 bits (106), Expect = 3e-05 Identities = 18/27 (66%), Positives = 24/27 (88%) Frame = -3 Query: 353 RLTKLTKAQSEYISIPVEGPYKPSAYR 273 +LTKLT+ Q++YI +PVEGPYKP+ YR Sbjct: 421 KLTKLTQEQADYIGVPVEGPYKPNHYR 447
>SAHH_SYNPX (Q7U9Y3) Adenosylhomocysteinase (EC 3.3.1.1)| (S-adenosyl-L-homocysteine hydrolase) (AdoHcyase) Length = 476 Score = 45.1 bits (105), Expect = 4e-05 Identities = 18/28 (64%), Positives = 25/28 (89%) Frame = -3 Query: 356 ARLTKLTKAQSEYISIPVEGPYKPSAYR 273 A+LT+L+K Q++YI++PVEGPYKP YR Sbjct: 448 AKLTELSKDQADYINVPVEGPYKPDHYR 475
>SAHH_TRIVA (P51540) Adenosylhomocysteinase (EC 3.3.1.1)| (S-adenosyl-L-homocysteine hydrolase) (AdoHcyase) Length = 486 Score = 43.9 bits (102), Expect = 1e-04 Identities = 18/26 (69%), Positives = 23/26 (88%) Frame = -3 Query: 350 LTKLTKAQSEYISIPVEGPYKPSAYR 273 LTKLT+ Q++YI++PVEGPYK AYR Sbjct: 460 LTKLTQKQADYINVPVEGPYKSDAYR 485
>SAHH_NOCFA (Q5YQS7) Adenosylhomocysteinase (EC 3.3.1.1)| (S-adenosyl-L-homocysteine hydrolase) (AdoHcyase) Length = 494 Score = 43.5 bits (101), Expect = 1e-04 Identities = 19/26 (73%), Positives = 21/26 (80%) Frame = -3 Query: 350 LTKLTKAQSEYISIPVEGPYKPSAYR 273 LTKLTK Q+EYI + VEGPYKP YR Sbjct: 468 LTKLTKDQAEYIGVDVEGPYKPEHYR 493
>SAHH_MYCTU (P60176) Adenosylhomocysteinase (EC 3.3.1.1)| (S-adenosyl-L-homocysteine hydrolase) (AdoHcyase) Length = 494 Score = 43.1 bits (100), Expect = 2e-04 Identities = 18/26 (69%), Positives = 21/26 (80%) Frame = -3 Query: 350 LTKLTKAQSEYISIPVEGPYKPSAYR 273 LTKLTK Q+EY+ + VEGPYKP YR Sbjct: 468 LTKLTKEQAEYLGVDVEGPYKPDHYR 493
>SAHH_MYCBO (Q7TWW7) Adenosylhomocysteinase (EC 3.3.1.1)| (S-adenosyl-L-homocysteine hydrolase) (AdoHcyase) Length = 494 Score = 43.1 bits (100), Expect = 2e-04 Identities = 18/26 (69%), Positives = 21/26 (80%) Frame = -3 Query: 350 LTKLTKAQSEYISIPVEGPYKPSAYR 273 LTKLTK Q+EY+ + VEGPYKP YR Sbjct: 468 LTKLTKEQAEYLGVDVEGPYKPDHYR 493
>SAHH_PSESM (Q87V73) Adenosylhomocysteinase (EC 3.3.1.1)| (S-adenosyl-L-homocysteine hydrolase) (AdoHcyase) Length = 469 Score = 42.7 bits (99), Expect = 2e-04 Identities = 17/26 (65%), Positives = 22/26 (84%) Frame = -3 Query: 350 LTKLTKAQSEYISIPVEGPYKPSAYR 273 +TKLTK Q++YI + VEGP+KP AYR Sbjct: 443 VTKLTKTQADYIGVTVEGPFKPDAYR 468
>SAHH_ANOGA (O76757) Adenosylhomocysteinase (EC 3.3.1.1)| (S-adenosyl-L-homocysteine hydrolase) (AdoHcyase) Length = 432 Score = 42.4 bits (98), Expect = 3e-04 Identities = 17/27 (62%), Positives = 22/27 (81%) Frame = -3 Query: 353 RLTKLTKAQSEYISIPVEGPYKPSAYR 273 +LTKL+ Q EY+++PVEGPYKP YR Sbjct: 405 KLTKLSARQPEYLNLPVEGPYKPEHYR 431
>SAHH_LEIDO (P36889) Adenosylhomocysteinase (EC 3.3.1.1)| (S-adenosyl-L-homocysteine hydrolase) (AdoHcyase) Length = 437 Score = 42.4 bits (98), Expect = 3e-04 Identities = 18/28 (64%), Positives = 22/28 (78%) Frame = -3 Query: 356 ARLTKLTKAQSEYISIPVEGPYKPSAYR 273 A+LTKLT Q+EYI+ PV GP+KP YR Sbjct: 409 AKLTKLTPKQAEYINCPVNGPFKPDHYR 436
>SAHH_YEAST (P39954) Adenosylhomocysteinase (EC 3.3.1.1)| (S-adenosyl-L-homocysteine hydrolase) (AdoHcyase) Length = 449 Score = 41.6 bits (96), Expect = 5e-04 Identities = 18/27 (66%), Positives = 21/27 (77%) Frame = -3 Query: 353 RLTKLTKAQSEYISIPVEGPYKPSAYR 273 RLTKL+K QSEY+ IP EGP+K YR Sbjct: 422 RLTKLSKVQSEYLGIPEEGPFKADHYR 448
>SAHH_DICDI (P10819) Adenosylhomocysteinase (EC 3.3.1.1)| (S-adenosyl-L-homocysteine hydrolase) (AdoHcyase) Length = 430 Score = 41.6 bits (96), Expect = 5e-04 Identities = 18/28 (64%), Positives = 22/28 (78%) Frame = -3 Query: 356 ARLTKLTKAQSEYISIPVEGPYKPSAYR 273 A+LT LT+ QSEY+S+PV GPYK YR Sbjct: 402 AKLTTLTEKQSEYLSVPVAGPYKVDHYR 429
>SAHH_PROMA (Q7V9P3) Adenosylhomocysteinase (EC 3.3.1.1)| (S-adenosyl-L-homocysteine hydrolase) (AdoHcyase) Length = 476 Score = 41.6 bits (96), Expect = 5e-04 Identities = 16/28 (57%), Positives = 23/28 (82%) Frame = -3 Query: 356 ARLTKLTKAQSEYISIPVEGPYKPSAYR 273 A LT+L+K Q++YI++P+EGPYK YR Sbjct: 448 ANLTELSKEQADYINVPIEGPYKSEQYR 475
>SAHH_BORPA (Q7W1Z7) Adenosylhomocysteinase (EC 3.3.1.1)| (S-adenosyl-L-homocysteine hydrolase) (AdoHcyase) Length = 472 Score = 41.2 bits (95), Expect = 6e-04 Identities = 16/28 (57%), Positives = 23/28 (82%) Frame = -3 Query: 356 ARLTKLTKAQSEYISIPVEGPYKPSAYR 273 A+L+ L+K Q++YI +PVEGP+KP YR Sbjct: 444 AKLSTLSKQQADYIGVPVEGPFKPGHYR 471
>SAHH_BORBR (Q7WQX5) Adenosylhomocysteinase (EC 3.3.1.1)| (S-adenosyl-L-homocysteine hydrolase) (AdoHcyase) Length = 472 Score = 41.2 bits (95), Expect = 6e-04 Identities = 16/28 (57%), Positives = 23/28 (82%) Frame = -3 Query: 356 ARLTKLTKAQSEYISIPVEGPYKPSAYR 273 A+L+ L+K Q++YI +PVEGP+KP YR Sbjct: 444 AKLSTLSKQQADYIGVPVEGPFKPGHYR 471
>SAHH_CHRVO (Q7NZF7) Adenosylhomocysteinase (EC 3.3.1.1)| (S-adenosyl-L-homocysteine hydrolase) (AdoHcyase) Length = 466 Score = 40.8 bits (94), Expect = 8e-04 Identities = 17/28 (60%), Positives = 22/28 (78%) Frame = -3 Query: 356 ARLTKLTKAQSEYISIPVEGPYKPSAYR 273 ARLT+L+ Q+ YIS+P +GPYKP YR Sbjct: 438 ARLTELSDQQAAYISVPKQGPYKPDHYR 465
>SAHH_MYCLE (Q9CCJ4) Adenosylhomocysteinase (EC 3.3.1.1)| (S-adenosyl-L-homocysteine hydrolase) (AdoHcyase) Length = 492 Score = 40.4 bits (93), Expect = 0.001 Identities = 16/27 (59%), Positives = 22/27 (81%) Frame = -3 Query: 353 RLTKLTKAQSEYISIPVEGPYKPSAYR 273 +LTKLTK Q+EY+ + V+GP+KP YR Sbjct: 465 QLTKLTKDQAEYLGVDVDGPFKPDHYR 491
>SAHH_METCA (Q60CG8) Adenosylhomocysteinase (EC 3.3.1.1)| (S-adenosyl-L-homocysteine hydrolase) (AdoHcyase) Length = 472 Score = 40.4 bits (93), Expect = 0.001 Identities = 17/28 (60%), Positives = 21/28 (75%) Frame = -3 Query: 356 ARLTKLTKAQSEYISIPVEGPYKPSAYR 273 ARLT+L+ Q+ YI +P EGPYKP YR Sbjct: 444 ARLTELSDEQAAYIGVPKEGPYKPDHYR 471
>SAHH_RAT (P10760) Adenosylhomocysteinase (EC 3.3.1.1)| (S-adenosyl-L-homocysteine hydrolase) (AdoHcyase) Length = 431 Score = 39.7 bits (91), Expect = 0.002 Identities = 14/27 (51%), Positives = 22/27 (81%) Frame = -3 Query: 353 RLTKLTKAQSEYISIPVEGPYKPSAYR 273 +LTKLT+ Q++Y+ +P+ GP+KP YR Sbjct: 404 KLTKLTEKQAQYLGMPINGPFKPDHYR 430
>SAHH_MOUSE (P50247) Adenosylhomocysteinase (EC 3.3.1.1)| (S-adenosyl-L-homocysteine hydrolase) (AdoHcyase) (Liver copper-binding protein) (CUBP) Length = 431 Score = 39.7 bits (91), Expect = 0.002 Identities = 14/27 (51%), Positives = 22/27 (81%) Frame = -3 Query: 353 RLTKLTKAQSEYISIPVEGPYKPSAYR 273 +LTKLT+ Q++Y+ +P+ GP+KP YR Sbjct: 404 KLTKLTEKQAQYLGMPINGPFKPDHYR 430
>SAHH_MYCPA (Q73UK6) Adenosylhomocysteinase (EC 3.3.1.1)| (S-adenosyl-L-homocysteine hydrolase) (AdoHcyase) Length = 496 Score = 39.7 bits (91), Expect = 0.002 Identities = 17/26 (65%), Positives = 20/26 (76%) Frame = -3 Query: 350 LTKLTKAQSEYISIPVEGPYKPSAYR 273 LTKLTK Q+EYI + V+GPYK YR Sbjct: 470 LTKLTKEQAEYIGVDVDGPYKADHYR 495
>SAHH_BORPE (Q7VUL8) Adenosylhomocysteinase (EC 3.3.1.1)| (S-adenosyl-L-homocysteine hydrolase) (AdoHcyase) Length = 472 Score = 39.7 bits (91), Expect = 0.002 Identities = 15/27 (55%), Positives = 22/27 (81%) Frame = -3 Query: 353 RLTKLTKAQSEYISIPVEGPYKPSAYR 273 +L+ L+K Q++YI +PVEGP+KP YR Sbjct: 445 KLSTLSKQQADYIGVPVEGPFKPDHYR 471
>SAHH_LEPIN (Q8EXV1) Adenosylhomocysteinase (EC 3.3.1.1)| (S-adenosyl-L-homocysteine hydrolase) (AdoHcyase) Length = 436 Score = 39.7 bits (91), Expect = 0.002 Identities = 14/27 (51%), Positives = 21/27 (77%) Frame = -3 Query: 353 RLTKLTKAQSEYISIPVEGPYKPSAYR 273 RLTKL + Q++Y+ +P+ GP+KP YR Sbjct: 409 RLTKLNQKQADYLGVPINGPFKPDHYR 435
>SAHH_LEPIC (Q75FU8) Adenosylhomocysteinase (EC 3.3.1.1)| (S-adenosyl-L-homocysteine hydrolase) (AdoHcyase) Length = 436 Score = 39.7 bits (91), Expect = 0.002 Identities = 14/27 (51%), Positives = 21/27 (77%) Frame = -3 Query: 353 RLTKLTKAQSEYISIPVEGPYKPSAYR 273 RLTKL + Q++Y+ +P+ GP+KP YR Sbjct: 409 RLTKLNQKQADYLGVPINGPFKPDHYR 435
>SAHH_COREF (Q8FRJ4) Adenosylhomocysteinase (EC 3.3.1.1)| (S-adenosyl-L-homocysteine hydrolase) (AdoHcyase) Length = 478 Score = 39.3 bits (90), Expect = 0.002 Identities = 16/27 (59%), Positives = 21/27 (77%) Frame = -3 Query: 353 RLTKLTKAQSEYISIPVEGPYKPSAYR 273 +LT+LTK Q+EYI + V GP+KP YR Sbjct: 451 KLTELTKEQAEYIGVDVAGPFKPEHYR 477
>SAHH_CORDI (P61456) Adenosylhomocysteinase (EC 3.3.1.1)| (S-adenosyl-L-homocysteine hydrolase) (AdoHcyase) Length = 478 Score = 39.3 bits (90), Expect = 0.002 Identities = 16/26 (61%), Positives = 20/26 (76%) Frame = -3 Query: 350 LTKLTKAQSEYISIPVEGPYKPSAYR 273 +T+LTK Q+EYI + V GPYKP YR Sbjct: 452 ITELTKEQAEYIGVDVAGPYKPEHYR 477
>SAHH_SCHPO (O13639) Adenosylhomocysteinase (EC 3.3.1.1)| (S-adenosyl-L-homocysteine hydrolase) (AdoHcyase) Length = 433 Score = 39.3 bits (90), Expect = 0.002 Identities = 16/27 (59%), Positives = 20/27 (74%) Frame = -3 Query: 353 RLTKLTKAQSEYISIPVEGPYKPSAYR 273 +LT LT QS+Y+ IPV+GPYK YR Sbjct: 406 KLTTLTSVQSDYLGIPVDGPYKADHYR 432
>SAHH_CORGL (Q8NSC4) Adenosylhomocysteinase (EC 3.3.1.1)| (S-adenosyl-L-homocysteine hydrolase) (AdoHcyase) Length = 474 Score = 38.9 bits (89), Expect = 0.003 Identities = 16/27 (59%), Positives = 21/27 (77%) Frame = -3 Query: 353 RLTKLTKAQSEYISIPVEGPYKPSAYR 273 +LT+LTK Q+EYI + V GP+KP YR Sbjct: 447 QLTELTKEQAEYIGVDVAGPFKPEHYR 473
>SAHH_CAEEL (P27604) Adenosylhomocysteinase (EC 3.3.1.1)| (S-adenosyl-L-homocysteine hydrolase) (AdoHcyase) (Protein dumpy-14) Length = 437 Score = 38.9 bits (89), Expect = 0.003 Identities = 15/27 (55%), Positives = 20/27 (74%) Frame = -3 Query: 353 RLTKLTKAQSEYISIPVEGPYKPSAYR 273 +LTKL+ Q+ Y+ +PV GPYKP YR Sbjct: 410 KLTKLSDEQASYLGVPVAGPYKPDHYR 436
>SAHH_ACIAD (Q6FA43) Adenosylhomocysteinase (EC 3.3.1.1)| (S-adenosyl-L-homocysteine hydrolase) (AdoHcyase) Length = 467 Score = 38.5 bits (88), Expect = 0.004 Identities = 14/26 (53%), Positives = 21/26 (80%) Frame = -3 Query: 350 LTKLTKAQSEYISIPVEGPYKPSAYR 273 LT+LT Q++Y+ +PVEGP+K AY+ Sbjct: 441 LTQLTSVQADYLGVPVEGPFKSDAYK 466
>SAHH_PSEAE (Q9I685) Adenosylhomocysteinase (EC 3.3.1.1)| (S-adenosyl-L-homocysteine hydrolase) (AdoHcyase) Length = 469 Score = 38.1 bits (87), Expect = 0.005 Identities = 15/26 (57%), Positives = 20/26 (76%) Frame = -3 Query: 350 LTKLTKAQSEYISIPVEGPYKPSAYR 273 +T+LT Q+EYI + VEGP+KP YR Sbjct: 443 VTQLTPKQAEYIGVSVEGPFKPDTYR 468
>SAHH_XANCP (Q8PCH5) Adenosylhomocysteinase (EC 3.3.1.1)| (S-adenosyl-L-homocysteine hydrolase) (AdoHcyase) Length = 480 Score = 37.7 bits (86), Expect = 0.007 Identities = 15/27 (55%), Positives = 20/27 (74%) Frame = -3 Query: 353 RLTKLTKAQSEYISIPVEGPYKPSAYR 273 +LT LTK Q++Y+ + V GPYKP YR Sbjct: 453 KLTTLTKDQADYLGVDVAGPYKPDHYR 479
>SAHH_XANAC (Q8PP84) Adenosylhomocysteinase (EC 3.3.1.1)| (S-adenosyl-L-homocysteine hydrolase) (AdoHcyase) Length = 480 Score = 37.7 bits (86), Expect = 0.007 Identities = 15/27 (55%), Positives = 20/27 (74%) Frame = -3 Query: 353 RLTKLTKAQSEYISIPVEGPYKPSAYR 273 +LT LTK Q++Y+ + V GPYKP YR Sbjct: 453 KLTTLTKDQADYLGVDVAGPYKPDHYR 479
>SAHH_STRFR (P26799) Adenosylhomocysteinase (EC 3.3.1.1)| (S-adenosyl-L-homocysteine hydrolase) (AdoHcyase) (Fragment) Length = 120 Score = 37.7 bits (86), Expect = 0.007 Identities = 16/27 (59%), Positives = 19/27 (70%) Frame = -3 Query: 353 RLTKLTKAQSEYISIPVEGPYKPSAYR 273 +LT L Q+EYI + VEGPYKP YR Sbjct: 93 KLTTLRPEQAEYIGVEVEGPYKPDHYR 119
>SAHH_PNECA (Q12663) Adenosylhomocysteinase (EC 3.3.1.1)| (S-adenosyl-L-homocysteine hydrolase) (AdoHcyase) (Fragment) Length = 440 Score = 37.4 bits (85), Expect = 0.009 Identities = 15/27 (55%), Positives = 19/27 (70%) Frame = -3 Query: 353 RLTKLTKAQSEYISIPVEGPYKPSAYR 273 +LT LT QS Y+ IP++GPYK YR Sbjct: 413 KLTSLTPEQSAYLDIPIDGPYKSEHYR 439
>SAHH_CAUCR (Q9ABH0) Adenosylhomocysteinase (EC 3.3.1.1)| (S-adenosyl-L-homocysteine hydrolase) (AdoHcyase) Length = 463 Score = 37.0 bits (84), Expect = 0.012 Identities = 15/28 (53%), Positives = 20/28 (71%) Frame = -3 Query: 356 ARLTKLTKAQSEYISIPVEGPYKPSAYR 273 A+LT L K Q++YI +P GP+KP YR Sbjct: 435 AKLTTLRKDQADYIGVPEAGPFKPDHYR 462
>SAHH_DESVH (Q72EH1) Adenosylhomocysteinase (EC 3.3.1.1)| (S-adenosyl-L-homocysteine hydrolase) (AdoHcyase) Length = 479 Score = 36.6 bits (83), Expect = 0.016 Identities = 14/27 (51%), Positives = 21/27 (77%) Frame = -3 Query: 353 RLTKLTKAQSEYISIPVEGPYKPSAYR 273 +LT+L+K Q++YI + EGP+KP YR Sbjct: 452 KLTRLSKDQADYIGVSPEGPFKPDHYR 478
>SAHH_PIG (Q710C4) Adenosylhomocysteinase (EC 3.3.1.1)| (S-adenosyl-L-homocysteine hydrolase) (AdoHcyase) Length = 431 Score = 36.2 bits (82), Expect = 0.020 Identities = 14/27 (51%), Positives = 21/27 (77%) Frame = -3 Query: 353 RLTKLTKAQSEYISIPVEGPYKPSAYR 273 +LTKLT+ Q++Y+ + EGP+KP YR Sbjct: 404 KLTKLTEKQAQYLGMSREGPFKPDHYR 430
>SAHHB_XENLA (O93477) Adenosylhomocysteinase B (EC 3.3.1.1)| (S-adenosyl-L-homocysteine hydrolase B) (AdoHcyase B) Length = 433 Score = 35.8 bits (81), Expect = 0.027 Identities = 14/27 (51%), Positives = 20/27 (74%) Frame = -3 Query: 353 RLTKLTKAQSEYISIPVEGPYKPSAYR 273 +LTKLT Q++Y+ + EGP+KP YR Sbjct: 406 KLTKLTDKQAKYLGLDKEGPFKPDHYR 432
>SAHHA_XENLA (P51893) Adenosylhomocysteinase A (EC 3.3.1.1)| (S-adenosyl-L-homocysteine hydrolase A) (AdoHcyase A) Length = 433 Score = 35.8 bits (81), Expect = 0.027 Identities = 14/27 (51%), Positives = 20/27 (74%) Frame = -3 Query: 353 RLTKLTKAQSEYISIPVEGPYKPSAYR 273 +LTKLT Q++Y+ + EGP+KP YR Sbjct: 406 KLTKLTDKQAKYLGLDKEGPFKPDHYR 432
>SAHH_HUMAN (P23526) Adenosylhomocysteinase (EC 3.3.1.1)| (S-adenosyl-L-homocysteine hydrolase) (AdoHcyase) Length = 431 Score = 35.8 bits (81), Expect = 0.027 Identities = 13/27 (48%), Positives = 21/27 (77%) Frame = -3 Query: 353 RLTKLTKAQSEYISIPVEGPYKPSAYR 273 +LTKLT+ Q++Y+ + +GP+KP YR Sbjct: 404 KLTKLTEKQAQYLGMSCDGPFKPDHYR 430
>SAHH_BACTN (Q8A407) Adenosylhomocysteinase (EC 3.3.1.1)| (S-adenosyl-L-homocysteine hydrolase) (AdoHcyase) Length = 476 Score = 35.8 bits (81), Expect = 0.027 Identities = 15/27 (55%), Positives = 19/27 (70%) Frame = -3 Query: 353 RLTKLTKAQSEYISIPVEGPYKPSAYR 273 +LTKLT Q+ YI + V+GPYK YR Sbjct: 449 KLTKLTPEQAAYIGVSVDGPYKAEHYR 475
>SAHH_BACFR (Q64MT2) Adenosylhomocysteinase (EC 3.3.1.1)| (S-adenosyl-L-homocysteine hydrolase) (AdoHcyase) Length = 487 Score = 35.8 bits (81), Expect = 0.027 Identities = 15/27 (55%), Positives = 19/27 (70%) Frame = -3 Query: 353 RLTKLTKAQSEYISIPVEGPYKPSAYR 273 +LTKLT Q+ YI + V+GPYK YR Sbjct: 460 KLTKLTPEQAAYIGVSVDGPYKADHYR 486
>SAHH_XYLFT (Q87EI8) Adenosylhomocysteinase (EC 3.3.1.1)| (S-adenosyl-L-homocysteine hydrolase) (AdoHcyase) Length = 480 Score = 35.4 bits (80), Expect = 0.035 Identities = 15/27 (55%), Positives = 19/27 (70%) Frame = -3 Query: 353 RLTKLTKAQSEYISIPVEGPYKPSAYR 273 +LT LT Q+ Y+ I VEGP+KP YR Sbjct: 453 KLTTLTANQAAYLGISVEGPFKPEHYR 479
>SAHH_XYLFA (Q9PEJ1) Adenosylhomocysteinase (EC 3.3.1.1)| (S-adenosyl-L-homocysteine hydrolase) (AdoHcyase) Length = 480 Score = 35.4 bits (80), Expect = 0.035 Identities = 15/27 (55%), Positives = 19/27 (70%) Frame = -3 Query: 353 RLTKLTKAQSEYISIPVEGPYKPSAYR 273 +LT LT Q+ Y+ I VEGP+KP YR Sbjct: 453 KLTTLTANQAAYLGISVEGPFKPEHYR 479
>SAHH_STRAZ (Q8GGL7) Adenosylhomocysteinase (EC 3.3.1.1)| (S-adenosyl-L-homocysteine hydrolase) (AdoHcyase) Length = 469 Score = 34.7 bits (78), Expect = 0.059 Identities = 14/27 (51%), Positives = 18/27 (66%) Frame = -3 Query: 353 RLTKLTKAQSEYISIPVEGPYKPSAYR 273 +LT L Q+ YI + V+GPYKP YR Sbjct: 442 KLTTLRPEQASYIGVEVDGPYKPDHYR 468
>SAHH_RHOPA (Q6N2N5) Adenosylhomocysteinase (EC 3.3.1.1)| (S-adenosyl-L-homocysteine hydrolase) (AdoHcyase) Length = 469 Score = 34.7 bits (78), Expect = 0.059 Identities = 14/27 (51%), Positives = 20/27 (74%) Frame = -3 Query: 353 RLTKLTKAQSEYISIPVEGPYKPSAYR 273 +LT+L K Q++YI + VEGP+K YR Sbjct: 442 KLTELRKDQADYIGVKVEGPFKADHYR 468
>SAHH_NITEU (Q82WL1) Adenosylhomocysteinase (EC 3.3.1.1)| (S-adenosyl-L-homocysteine hydrolase) (AdoHcyase) Length = 478 Score = 34.3 bits (77), Expect = 0.077 Identities = 13/27 (48%), Positives = 19/27 (70%) Frame = -3 Query: 353 RLTKLTKAQSEYISIPVEGPYKPSAYR 273 +LT+LT Q+ Y+++ GPYKP YR Sbjct: 451 KLTELTDEQAHYLNLDKNGPYKPEMYR 477
>SAHH_RHILO (Q98CM3) Adenosylhomocysteinase (EC 3.3.1.1)| (S-adenosyl-L-homocysteine hydrolase) (AdoHcyase) Length = 466 Score = 34.3 bits (77), Expect = 0.077 Identities = 14/28 (50%), Positives = 20/28 (71%) Frame = -3 Query: 356 ARLTKLTKAQSEYISIPVEGPYKPSAYR 273 ARLT+L+ Q+ YI + +GP+KP YR Sbjct: 438 ARLTELSGEQAAYIGVTPQGPFKPEHYR 465
>SAHH_DROME (Q27580) Adenosylhomocysteinase (EC 3.3.1.1)| (S-adenosyl-L-homocysteine hydrolase) (AdoHcyase) Length = 432 Score = 33.9 bits (76), Expect = 0.10 Identities = 13/27 (48%), Positives = 19/27 (70%) Frame = -3 Query: 353 RLTKLTKAQSEYISIPVEGPYKPSAYR 273 +LTKLT+ Q+ Y+ + GP+KP YR Sbjct: 405 KLTKLTEKQATYLGVSQTGPFKPDHYR 431
>SAHH_BRAJA (Q89HP6) Adenosylhomocysteinase (EC 3.3.1.1)| (S-adenosyl-L-homocysteine hydrolase) (AdoHcyase) Length = 473 Score = 33.9 bits (76), Expect = 0.10 Identities = 14/27 (51%), Positives = 19/27 (70%) Frame = -3 Query: 353 RLTKLTKAQSEYISIPVEGPYKPSAYR 273 +LT+L K Q++YI + EGPYK YR Sbjct: 446 KLTELRKDQADYIGVKQEGPYKSDHYR 472
>SAHH_STRCO (Q9KZM1) Adenosylhomocysteinase (EC 3.3.1.1)| (S-adenosyl-L-homocysteine hydrolase) (AdoHcyase) Length = 485 Score = 33.5 bits (75), Expect = 0.13 Identities = 14/27 (51%), Positives = 18/27 (66%) Frame = -3 Query: 353 RLTKLTKAQSEYISIPVEGPYKPSAYR 273 +LT L Q++YI + VEGPYK YR Sbjct: 458 KLTTLRPEQADYIGVKVEGPYKADHYR 484
>SAHH_BARHE (Q6G584) Adenosylhomocysteinase (EC 3.3.1.1)| (S-adenosyl-L-homocysteine hydrolase) (AdoHcyase) Length = 465 Score = 33.5 bits (75), Expect = 0.13 Identities = 13/27 (48%), Positives = 19/27 (70%) Frame = -3 Query: 353 RLTKLTKAQSEYISIPVEGPYKPSAYR 273 +LT L++ Q+ YI + +GPYKP YR Sbjct: 438 KLTTLSQEQAAYIGVTPQGPYKPDHYR 464
>SAHH3_PONPY (Q5R889) Putative adenosylhomocysteinase 3 (EC 3.3.1.1)| (S-adenosyl-L-homocysteine hydrolase 3) (AdoHcyase 3) Length = 508 Score = 33.1 bits (74), Expect = 0.17 Identities = 13/28 (46%), Positives = 20/28 (71%) Frame = -3 Query: 356 ARLTKLTKAQSEYISIPVEGPYKPSAYR 273 A LT+LT Q++Y+ + GP+KP+ YR Sbjct: 480 AHLTELTDEQAKYLGLNKNGPFKPNYYR 507
>SAHH3_MOUSE (Q68FL4) Putative adenosylhomocysteinase 3 (EC 3.3.1.1)| (S-adenosyl-L-homocysteine hydrolase 3) (AdoHcyase 3) Length = 613 Score = 33.1 bits (74), Expect = 0.17 Identities = 13/28 (46%), Positives = 20/28 (71%) Frame = -3 Query: 356 ARLTKLTKAQSEYISIPVEGPYKPSAYR 273 A LT+LT Q++Y+ + GP+KP+ YR Sbjct: 585 AHLTELTDEQAKYLGLNKNGPFKPNYYR 612
>SAHH3_HUMAN (Q96HN2) Putative adenosylhomocysteinase 3 (EC 3.3.1.1)| (S-adenosyl-L-homocysteine hydrolase 3) (AdoHcyase 3) Length = 611 Score = 33.1 bits (74), Expect = 0.17 Identities = 13/28 (46%), Positives = 20/28 (71%) Frame = -3 Query: 356 ARLTKLTKAQSEYISIPVEGPYKPSAYR 273 A LT+LT Q++Y+ + GP+KP+ YR Sbjct: 583 AHLTELTDEQAKYLGLNKNGPFKPNYYR 610
>SAHH_RHOCA (P28183) Adenosylhomocysteinase (EC 3.3.1.1)| (S-adenosyl-L-homocysteine hydrolase) (AdoHcyase) Length = 463 Score = 32.7 bits (73), Expect = 0.22 Identities = 14/27 (51%), Positives = 18/27 (66%) Frame = -3 Query: 353 RLTKLTKAQSEYISIPVEGPYKPSAYR 273 +LT L Q+EYI + VEGP+K YR Sbjct: 436 KLTTLRPDQAEYIGVTVEGPFKSDHYR 462
>SAHH_COXBU (Q83A77) Adenosylhomocysteinase (EC 3.3.1.1)| (S-adenosyl-L-homocysteine hydrolase) (AdoHcyase) Length = 429 Score = 32.7 bits (73), Expect = 0.22 Identities = 13/27 (48%), Positives = 19/27 (70%) Frame = -3 Query: 353 RLTKLTKAQSEYISIPVEGPYKPSAYR 273 +LT LT+ Q++YI + EGP+K YR Sbjct: 402 KLTTLTEKQADYIGVDPEGPFKSEHYR 428
>SAHH2_MOUSE (Q80SW1) Putative adenosylhomocysteinase 2 (EC 3.3.1.1)| (S-adenosyl-L-homocysteine hydrolase 2) (AdoHcyase 2) (S-adenosylhomocysteine hydrolase-like 1) (IP3R-binding protein released with inositol 1,4,5-trisphosphate) Length = 530 Score = 32.7 bits (73), Expect = 0.22 Identities = 13/28 (46%), Positives = 20/28 (71%) Frame = -3 Query: 356 ARLTKLTKAQSEYISIPVEGPYKPSAYR 273 A LT+LT Q++Y+ + GP+KP+ YR Sbjct: 502 AHLTELTDDQAKYLGLNKNGPFKPNYYR 529
>SAHH2_HUMAN (O43865) Putative adenosylhomocysteinase 2 (EC 3.3.1.1)| (S-adenosyl-L-homocysteine hydrolase 2) (AdoHcyase 2) (S-adenosylhomocysteine hydrolase-like 1) (DC-expressed AHCY-like molecule) Length = 530 Score = 32.7 bits (73), Expect = 0.22 Identities = 13/28 (46%), Positives = 20/28 (71%) Frame = -3 Query: 356 ARLTKLTKAQSEYISIPVEGPYKPSAYR 273 A LT+LT Q++Y+ + GP+KP+ YR Sbjct: 502 AHLTELTDDQAKYLGLNKNGPFKPNYYR 529
>SAHH_BDEBA (Q6MNC0) Adenosylhomocysteinase (EC 3.3.1.1)| (S-adenosyl-L-homocysteine hydrolase) (AdoHcyase) Length = 460 Score = 32.7 bits (73), Expect = 0.22 Identities = 12/27 (44%), Positives = 20/27 (74%) Frame = -3 Query: 353 RLTKLTKAQSEYISIPVEGPYKPSAYR 273 +LTKL+ Q++Y+ + +GP+KP YR Sbjct: 433 KLTKLSSKQAKYLHMSPQGPFKPEHYR 459
>SAHH_STRAA (Q936D6) Adenosylhomocysteinase (EC 3.3.1.1)| (S-adenosyl-L-homocysteine hydrolase) (AdoHcyase) Length = 482 Score = 31.6 bits (70), Expect = 0.50 Identities = 13/27 (48%), Positives = 17/27 (62%) Frame = -3 Query: 353 RLTKLTKAQSEYISIPVEGPYKPSAYR 273 +LT L Q+ YI + V+GPYK YR Sbjct: 455 KLTTLRPEQASYIGVDVDGPYKSDHYR 481
>SAHH_ROSDE (Q9ZNA5) Adenosylhomocysteinase (EC 3.3.1.1)| (S-adenosyl-L-homocysteine hydrolase) (AdoHcyase) Length = 462 Score = 31.6 bits (70), Expect = 0.50 Identities = 13/27 (48%), Positives = 17/27 (62%) Frame = -3 Query: 353 RLTKLTKAQSEYISIPVEGPYKPSAYR 273 +LT L Q+ YI + EGP+KP YR Sbjct: 435 KLTPLDPEQAAYIGVKPEGPFKPEHYR 461
>SAHH_AGRT5 (Q8UJ99) Adenosylhomocysteinase (EC 3.3.1.1)| (S-adenosyl-L-homocysteine hydrolase) (AdoHcyase) Length = 466 Score = 31.6 bits (70), Expect = 0.50 Identities = 13/27 (48%), Positives = 19/27 (70%) Frame = -3 Query: 353 RLTKLTKAQSEYISIPVEGPYKPSAYR 273 RLT+L+ Q++YI I +GP+K YR Sbjct: 439 RLTELSDLQADYIGISKQGPFKAEHYR 465
>SAHH_BARQU (Q6G1D6) Adenosylhomocysteinase (EC 3.3.1.1)| (S-adenosyl-L-homocysteine hydrolase) (AdoHcyase) Length = 465 Score = 31.6 bits (70), Expect = 0.50 Identities = 12/27 (44%), Positives = 20/27 (74%) Frame = -3 Query: 353 RLTKLTKAQSEYISIPVEGPYKPSAYR 273 +L+ L++ Q+ YI + +GPYKP+ YR Sbjct: 438 KLSVLSEEQAVYIGVTPQGPYKPNHYR 464
>SAHH_RHOSH (O50562) Adenosylhomocysteinase (EC 3.3.1.1)| (S-adenosyl-L-homocysteine hydrolase) (AdoHcyase) Length = 463 Score = 30.8 bits (68), Expect = 0.85 Identities = 12/27 (44%), Positives = 18/27 (66%) Frame = -3 Query: 353 RLTKLTKAQSEYISIPVEGPYKPSAYR 273 +LT + Q++YI + VEGP+K YR Sbjct: 436 KLTDVRPEQADYIGVKVEGPFKAEHYR 462
>SAHH_STRAW (Q82DC9) Adenosylhomocysteinase (EC 3.3.1.1)| (S-adenosyl-L-homocysteine hydrolase) (AdoHcyase) Length = 485 Score = 30.8 bits (68), Expect = 0.85 Identities = 13/27 (48%), Positives = 17/27 (62%) Frame = -3 Query: 353 RLTKLTKAQSEYISIPVEGPYKPSAYR 273 +LT L Q+ YI + VEGP+K YR Sbjct: 458 KLTTLRPEQAAYIGVEVEGPFKSDHYR 484
>OSA_DROME (Q8IN94) Trithorax group protein osa (Protein eyelid)| Length = 2716 Score = 30.8 bits (68), Expect = 0.85 Identities = 12/23 (52%), Positives = 15/23 (65%) Frame = +1 Query: 64 KQTPPPSTNPNRSKNVTMTNPPP 132 +QTPPP+ PN+ N T PPP Sbjct: 594 QQTPPPAPPPNQGMNNMATPPPP 616
>SAHH_BURPS (Q63PT2) Adenosylhomocysteinase (EC 3.3.1.1)| (S-adenosyl-L-homocysteine hydrolase) (AdoHcyase) Length = 473 Score = 30.0 bits (66), Expect = 1.5 Identities = 12/28 (42%), Positives = 19/28 (67%) Frame = -3 Query: 356 ARLTKLTKAQSEYISIPVEGPYKPSAYR 273 A+L++L+ Q+ YI + GP+KP YR Sbjct: 445 AQLSELSDDQAAYIGVSKAGPFKPDHYR 472
>SAHH_BURMA (Q62G22) Adenosylhomocysteinase (EC 3.3.1.1)| (S-adenosyl-L-homocysteine hydrolase) (AdoHcyase) Length = 473 Score = 30.0 bits (66), Expect = 1.5 Identities = 12/28 (42%), Positives = 19/28 (67%) Frame = -3 Query: 356 ARLTKLTKAQSEYISIPVEGPYKPSAYR 273 A+L++L+ Q+ YI + GP+KP YR Sbjct: 445 AQLSELSDDQAAYIGVSKAGPFKPDHYR 472
>OTX_STRPU (Q26417) Homeobox protein OTX (SPOTX)| Length = 371 Score = 29.6 bits (65), Expect = 1.9 Identities = 13/41 (31%), Positives = 20/41 (48%) Frame = +1 Query: 10 RQITPRLNQNNNAIISGQKQTPPPSTNPNRSKNVTMTNPPP 132 +Q P N N +K+TPPP+ N + T ++ PP Sbjct: 193 QQNGPNSNNTTNKPRPAKKKTPPPTPRENDAPTTTSSDTPP 233
>SAHH_PLACH (Q4XZZ5) Adenosylhomocysteinase (EC 3.3.1.1)| (S-adenosyl-L-homocysteine hydrolase) (AdoHcyase) Length = 479 Score = 28.9 bits (63), Expect = 3.2 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = -3 Query: 356 ARLTKLTKAQSEYISIPVEGPYKPSAYR 273 A LT+L Q E++ + GP+K AYR Sbjct: 451 ATLTELDDNQCEFLGVSKNGPFKSEAYR 478
>SAHH_PLAYO (Q7RKK8) Adenosylhomocysteinase (EC 3.3.1.1)| (S-adenosyl-L-homocysteine hydrolase) (AdoHcyase) Length = 479 Score = 28.5 bits (62), Expect = 4.2 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = -3 Query: 356 ARLTKLTKAQSEYISIPVEGPYKPSAYR 273 A LT+L Q E++ + GP+K AYR Sbjct: 451 ATLTELDDNQCEFLGVSKTGPFKSEAYR 478
>P2RY2_HUMAN (P41231) P2Y purinoceptor 2 (P2Y2) (P2U purinoceptor 1) (P2U1) (ATP| receptor) (Purinergic receptor) Length = 377 Score = 28.5 bits (62), Expect = 4.2 Identities = 14/23 (60%), Positives = 15/23 (65%) Frame = -1 Query: 280 PTGNSASTPARLAAGLSLSRRTD 212 PTG S +TPAR GL S RTD Sbjct: 323 PTGPSPATPARRRLGLRRSDRTD 345
>THYG_BOVIN (P01267) Thyroglobulin precursor| Length = 2769 Score = 28.5 bits (62), Expect = 4.2 Identities = 13/38 (34%), Positives = 17/38 (44%), Gaps = 9/38 (23%) Frame = +2 Query: 218 APAQAQPSR*SCW---------SGRTITGRQTACRDPQ 304 +P Q P++ SCW G + G Q AC PQ Sbjct: 1177 SPVQCDPAQGSCWCVLGSGEEVPGTRVAGSQPACESPQ 1214
>PDE4A_DROME (Q9W4T4) cAMP-specific 3',5'-cyclic phosphodiesterase, isoform I| (EC 3.1.4.17) (Learning/memory process protein) (Protein dunce) Length = 1209 Score = 28.5 bits (62), Expect = 4.2 Identities = 19/62 (30%), Positives = 28/62 (45%), Gaps = 6/62 (9%) Frame = +1 Query: 79 PSTNP------NRSKNVTMTNPPPKRQHA*I*IDNAKENRIVHTSPRQSSRRCACSGSAQ 240 PSTNP N+ +N +NP P N+ +T+P Q+ +RC+C Sbjct: 281 PSTNPCQSAVQNQGQN---SNPNP--------------NQNPNTNPNQNQQRCSCQPQTS 323 Query: 241 PL 246 PL Sbjct: 324 PL 325
>AEX3_CAEEL (O02626) Regulator of presynaptic activity aex-3 (Aboc, expulsion| defective protein 3) Length = 1409 Score = 28.1 bits (61), Expect = 5.5 Identities = 12/43 (27%), Positives = 18/43 (41%) Frame = +1 Query: 4 LNRQITPRLNQNNNAIISGQKQTPPPSTNPNRSKNVTMTNPPP 132 L + +TP N+ S + PP P + + NPPP Sbjct: 941 LGQNVTPTSTNNHEIAQSTRSPALPPPVPPREAPPIPKRNPPP 983
>KLK6_MOUSE (P15947) Glandular kallikrein K6 precursor (EC 3.4.21.35) (Tissue| kallikrein-6) (mGK-6) (Renal kallikrein) (KAL-B) Length = 261 Score = 27.7 bits (60), Expect = 7.2 Identities = 15/34 (44%), Positives = 19/34 (55%) Frame = +3 Query: 216 VRLLRLSPAASRAGVDALLPVGRRLVGTLNWDAN 317 +R L L A S G+DA PV R+VG N + N Sbjct: 1 MRFLILFLALSLGGIDAAPPVQSRIVGGFNCEKN 34
>Y564_MYCLE (Q9CCN9) Hypothetical UPF0052 protein ML0564| Length = 359 Score = 27.7 bits (60), Expect = 7.2 Identities = 13/35 (37%), Positives = 21/35 (60%) Frame = +3 Query: 216 VRLLRLSPAASRAGVDALLPVGRRLVGTLNWDANV 320 VRLL + P A+R VDA++ ++G +W +V Sbjct: 172 VRLLPVDPPATRQAVDAIMAANLVVLGPGSWFTSV 206
>CNTN2_CHICK (P28685) Contactin-2 precursor (Axonin-1)| Length = 1036 Score = 27.7 bits (60), Expect = 7.2 Identities = 13/37 (35%), Positives = 19/37 (51%) Frame = +1 Query: 28 LNQNNNAIISGQKQTPPPSTNPNRSKNVTMTNPPPKR 138 LN N +S + + P+ S N+T T PPP+R Sbjct: 874 LNPNTKYHVSVRAYNRAGAGPPSPSTNITTTKPPPRR 910
>NCOR2_HUMAN (Q9Y618) Nuclear receptor corepressor 2 (N-CoR2) (Silencing mediator| of retinoic acid and thyroid hormone receptor) (SMRT) (SMRTe) (Thyroid-, retinoic-acid-receptor-associated corepressor) (T3 receptor-associating factor) (TRAC) (CTG repeat p Length = 2517 Score = 27.3 bits (59), Expect = 9.4 Identities = 15/66 (22%), Positives = 32/66 (48%) Frame = +1 Query: 16 ITPRLNQNNNAIISGQKQTPPPSTNPNRSKNVTMTNPPPKRQHA*I*IDNAKENRIVHTS 195 I P L + + ++ + P + + R VTM P P+ Q + A ++R + ++ Sbjct: 1529 IVPELGKPRQSPLTYEDHGAPFAGHLPRGSPVTMREPTPRLQEGSLSSSKASQDRKLTST 1588 Query: 196 PRQSSR 213 PR+ ++ Sbjct: 1589 PREIAK 1594
>ABIL2_ARATH (Q9M3A3) Protein ABIL2 (Abl interactor-like protein 2) (AtABIL2)| Length = 312 Score = 27.3 bits (59), Expect = 9.4 Identities = 11/35 (31%), Positives = 20/35 (57%) Frame = +1 Query: 31 NQNNNAIISGQKQTPPPSTNPNRSKNVTMTNPPPK 135 NQ NA+ + ++TPPP + S++ + PP + Sbjct: 164 NQFRNAVRATIRETPPPPVRKSTSQSSSPRQPPQR 198
>YJ53_YEAST (P47129) Hypothetical 35.5 kDa protein in MIR1-STE18 intergenic| region Length = 309 Score = 27.3 bits (59), Expect = 9.4 Identities = 14/42 (33%), Positives = 21/42 (50%), Gaps = 7/42 (16%) Frame = +1 Query: 28 LNQNNNAIISGQKQTPPPSTN-------PNRSKNVTMTNPPP 132 +N N N + +K PPP+ + P+RS T T+ PP Sbjct: 177 VNSNINNTLPNRKPNPPPNRSQRMQNIAPSRSSESTPTSGPP 218
>USP_DROME (P20153) Protein ultraspiracle (XR2C) (Chorion factor 1)| Length = 508 Score = 27.3 bits (59), Expect = 9.4 Identities = 18/52 (34%), Positives = 27/52 (51%), Gaps = 2/52 (3%) Frame = -1 Query: 283 LPTGNSASTPARLAAGLSLSRRTD--GNSASATYELSCFPLHYLSRSRHVVS 134 LP NSAS+ A +++ + G SA+A + P H LS S+H+ S Sbjct: 54 LPGSNSASSNNNSAGDAQMAQAPNSAGGSAAAAVQQQYPPNHPLSGSKHLCS 105
>WBP11_HUMAN (Q9Y2W2) WW domain-binding protein 11 (WBP-11) (SH3 domain-binding| protein SNP70) (Npw38-binding protein) (NpwBP) Length = 641 Score = 27.3 bits (59), Expect = 9.4 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +1 Query: 31 NQNNNAIISGQKQTPPPSTNPNRSKNVTMTNPPP 132 + + + S Q+Q PP S P++ + M PPP Sbjct: 379 HSDGTSTASSQQQAPPQSVPPSQIQAPPMPGPPP 412
>DLG7_HUMAN (Q15398) Discs large homolog 7 (Hepatoma up-regulated protein)| (HURP) Length = 846 Score = 27.3 bits (59), Expect = 9.4 Identities = 20/63 (31%), Positives = 27/63 (42%) Frame = +1 Query: 28 LNQNNNAIISGQKQTPPPSTNPNRSKNVTMTNPPPKRQHA*I*IDNAKENRIVHTSPRQS 207 L N NA+ + K+ P S RSK K Q IDN + R + PRQ+ Sbjct: 131 LLSNQNAVKAEPKKAIPSSVRITRSK--------AKDQMEQTKIDNESDVRAIRPGPRQT 182 Query: 208 SRR 216 S + Sbjct: 183 SEK 185 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 50,383,188 Number of Sequences: 219361 Number of extensions: 945003 Number of successful extensions: 2819 Number of sequences better than 10.0: 100 Number of HSP's better than 10.0 without gapping: 2611 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2805 length of database: 80,573,946 effective HSP length: 94 effective length of database: 59,954,012 effective search space used: 1438896288 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
