| Clone Name | rbaet04a10 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | IBBB_PEA (P56679) Seed trypsin/chymotrypsin inhibitor IVB (PSTI-... | 30 | 1.2 | 2 | RBBP6_MOUSE (P97868) Retinoblastoma-binding protein 6 (p53-assoc... | 30 | 1.5 | 3 | IBBA_PEA (Q41065) Seed trypsin/chymotrypsin inhibitor IVA precur... | 29 | 2.6 |
|---|
>IBBB_PEA (P56679) Seed trypsin/chymotrypsin inhibitor IVB (PSTI-IVB)| [Contains: Seed trypsin/chymotrypsin inhibitor II (PSTI II)] Length = 72 Score = 30.4 bits (67), Expect = 1.2 Identities = 15/33 (45%), Positives = 15/33 (45%), Gaps = 1/33 (3%) Frame = -1 Query: 159 TCQLACWLLSRASDNPKKCVCV*TSSMC-KYCH 64 TC AC A NP KC C T C K CH Sbjct: 30 TCHSACLSCICAYSNPPKCQCFDTQKFCYKACH 62
>RBBP6_MOUSE (P97868) Retinoblastoma-binding protein 6 (p53-associated cellular| protein of testis) (Proliferation potential-related protein) (Protein P2P-R) Length = 1790 Score = 30.0 bits (66), Expect = 1.5 Identities = 21/70 (30%), Positives = 32/70 (45%) Frame = +2 Query: 98 QTHFFGLSLALDRSQQAS*HVPVSGSTNRDSKLLGTE*QDKIATY*IINYVLDNHKDQQT 277 Q HF LS + ++ + H V GS+N+D T +DK Y +Y +D++ Sbjct: 1438 QGHFKTLSQSSKETRTSEKHESVRGSSNKDF----TPGRDKKVDYDSRDYSSSKRRDERG 1493 Query: 278 WRDRETDQPP 307 R D PP Sbjct: 1494 ELARRKDSPP 1503
>IBBA_PEA (Q41065) Seed trypsin/chymotrypsin inhibitor IVA precursor (PSTI| IVA) (TI12-36) [Contains: Seed trypsin/chymotrypsin inhibitor I (PSTI I)] (Fragment) Length = 96 Score = 29.3 bits (64), Expect = 2.6 Identities = 15/33 (45%), Positives = 15/33 (45%), Gaps = 1/33 (3%) Frame = -1 Query: 159 TCQLACWLLSRASDNPKKCVCV*TSSMC-KYCH 64 TC AC A NP KC C T C K CH Sbjct: 54 TCHSACDSCICAYSNPPKCQCFDTHKFCYKACH 86 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 42,253,004 Number of Sequences: 219361 Number of extensions: 680011 Number of successful extensions: 1287 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1260 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1287 length of database: 80,573,946 effective HSP length: 83 effective length of database: 62,366,983 effective search space used: 1496807592 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)