| Clone Name | rbaet03f02 |
|---|---|
| Clone Library Name | barley_pub |
>ZRP4_MAIZE (P47917) O-methyltransferase ZRP4 (EC 2.1.1.-) (OMT)| Length = 364 Score = 45.8 bits (107), Expect = 3e-05 Identities = 19/31 (61%), Positives = 25/31 (80%) Frame = -3 Query: 375 KEWSMLFMKAGFSDYKIIKKLGHRGVIEVYP 283 +EWS +F +AG+SDY+II LG R +IEVYP Sbjct: 334 QEWSKIFSEAGYSDYRIIPVLGVRSIIEVYP 364
>7OMT9_MEDSA (O22309) Isoflavone-7-O-methytransferase 9 (EC 2.1.1.150)| (Isoflavone-O-methytransferase 9) (7 IOMT-9) Length = 352 Score = 36.6 bits (83), Expect = 0.015 Identities = 15/31 (48%), Positives = 20/31 (64%) Frame = -3 Query: 375 KEWSMLFMKAGFSDYKIIKKLGHRGVIEVYP 283 +EW LF++AGF YKI G +IE+YP Sbjct: 322 EEWKKLFIEAGFQHYKISPLTGFLSLIEIYP 352
>7OMT8_MEDSA (O24529) Isoflavone-7-O-methytransferase 8 (EC 2.1.1.150)| (Isoflavone-O-methytransferase 8) (7-IOMT-8) Length = 352 Score = 36.6 bits (83), Expect = 0.015 Identities = 15/31 (48%), Positives = 20/31 (64%) Frame = -3 Query: 375 KEWSMLFMKAGFSDYKIIKKLGHRGVIEVYP 283 +EW LF++AGF YKI G +IE+YP Sbjct: 322 EEWKKLFIEAGFQHYKISPLTGFLSLIEIYP 352
>7OMT6_MEDSA (O22308) Isoflavone-7-O-methytransferase 6 (EC 2.1.1.150)| (Isoflavone-O-methytransferase 6) (7-IOMT-6) Length = 352 Score = 36.6 bits (83), Expect = 0.015 Identities = 15/31 (48%), Positives = 20/31 (64%) Frame = -3 Query: 375 KEWSMLFMKAGFSDYKIIKKLGHRGVIEVYP 283 +EW LF++AGF YKI G +IE+YP Sbjct: 322 EEWKKLFIEAGFQHYKISPLTGFLSLIEIYP 352
>CVMT1_OCIBA (Q93WU3) Chavicol O-methyltransferase (EC 2.1.1.146) ((Iso)eugenol| O-methyltransferase CVOMT1) (S-adenosysl-L-methionine:(Iso)eugenol O-methyltransferase CVOMT1) Length = 356 Score = 34.3 bits (77), Expect = 0.075 Identities = 14/30 (46%), Positives = 17/30 (56%) Frame = -3 Query: 372 EWSMLFMKAGFSDYKIIKKLGHRGVIEVYP 283 EW L AGF+ YK+ G R +IE YP Sbjct: 327 EWEKLISAAGFTSYKLTPAFGVRSLIEAYP 356
>EOMT1_OCIBA (Q93WU2) Eugenol O-methyltransferase (EC 2.1.1.146) ((Iso)eugenol| O-methyltransferase EOMT1) (S-adenosysl-L-methionine:(Iso)eugenol O-methyltransferase EOMT1) Length = 357 Score = 33.9 bits (76), Expect = 0.098 Identities = 14/30 (46%), Positives = 16/30 (53%) Frame = -3 Query: 372 EWSMLFMKAGFSDYKIIKKLGHRGVIEVYP 283 EW L AGF YK+ G R +IE YP Sbjct: 328 EWEKLIYDAGFKSYKLTPAFGVRSLIEAYP 357
>6OMT_COPJA (Q9LEL6) (RS)-norcoclaurine 6-O-methyltransferase (EC 2.1.1.128)| (S-adenosyl-L-methionine:norcoclaurine 6-O-methyltransferase) (6-OMT) Length = 347 Score = 28.1 bits (61), Expect = 5.4 Identities = 12/31 (38%), Positives = 17/31 (54%) Frame = -3 Query: 375 KEWSMLFMKAGFSDYKIIKKLGHRGVIEVYP 283 +EW L AG+ +KI + + VIE YP Sbjct: 316 EEWKKLIHDAGYKGHKITQITAVQSVIEAYP 346 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 40,020,014 Number of Sequences: 219361 Number of extensions: 608948 Number of successful extensions: 1062 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 1053 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1060 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 1402043640 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)