| Clone Name | rbaet03c07 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | ACVS_STRCL (Q01757) N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D... | 29 | 3.9 |
|---|
>ACVS_STRCL (Q01757) N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine| synthase (EC 6.3.2.26) (Delta-(L-alpha-aminoadipyl)-L-cysteinyl-D-valine synthetase) (ACV synthetase) (ACVS) (Fragment) Length = 805 Score = 28.9 bits (63), Expect = 3.9 Identities = 12/30 (40%), Positives = 19/30 (63%) Frame = +1 Query: 25 VQSGDIKARSTFYCGARRCLDAPRHNRIGG 114 V+ G+I+A++T Y G R+C+ R GG Sbjct: 688 VEPGEIEAQATEYAGVRKCVVIAREGAGGG 717 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 27,519,305 Number of Sequences: 219361 Number of extensions: 440844 Number of successful extensions: 1385 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 1378 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1385 length of database: 80,573,946 effective HSP length: 35 effective length of database: 72,896,311 effective search space used: 1749511464 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)