| Clone Name | rbaet01g03 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | ATG17_SCHPO (O42651) Autophagy-related protein 17 | 29 | 3.7 | 2 | TOF1_YEAST (P53840) Topoisomerase 1-associated factor 1 | 28 | 6.4 | 3 | PURA_BDEBA (Q6MN06) Adenylosuccinate synthetase (EC 6.3.4.4) (IM... | 28 | 6.4 | 4 | Y423_MYCGE (P47662) Hypothetical protein MG423 | 28 | 8.3 | 5 | Y493_HAEIN (O05023) Hypothetical transposase-like protein HI0493 | 28 | 8.3 |
|---|
>ATG17_SCHPO (O42651) Autophagy-related protein 17| Length = 481 Score = 28.9 bits (63), Expect = 3.7 Identities = 10/26 (38%), Positives = 17/26 (65%) Frame = -3 Query: 100 CFLQCFSIFCCRRSHVHVLNNLFYCV 23 C+++ +IF RR H +L+N F C+ Sbjct: 2 CYMRSLAIFQFRRKHTTLLHNQFLCI 27
>TOF1_YEAST (P53840) Topoisomerase 1-associated factor 1| Length = 1238 Score = 28.1 bits (61), Expect = 6.4 Identities = 13/38 (34%), Positives = 24/38 (63%) Frame = +2 Query: 104 PIINTQGGWLQSRSSYSVLSDKNIAADMASQLGEVVDE 217 P+ N++ G+ Q Y+VL+++++ A ASQ + DE Sbjct: 767 PLHNSEVGFYQRYGEYNVLNNESMYAAPASQFKPIPDE 804
>PURA_BDEBA (Q6MN06) Adenylosuccinate synthetase (EC 6.3.4.4) (IMP--aspartate| ligase) (AdSS) (AMPSase) Length = 432 Score = 28.1 bits (61), Expect = 6.4 Identities = 17/52 (32%), Positives = 23/52 (44%), Gaps = 5/52 (9%) Frame = +2 Query: 89 LEETAPIINTQGGWLQSRSSYSVLSD-----KNIAADMASQLGEVVDELDGG 229 LE+ P+I GW Q + LSD N + SQLG +D + G Sbjct: 366 LEKVEPVIEWIPGWTQDLTKVKTLSDLPRPTTNYIDYLGSQLGTPIDVISVG 417
>Y423_MYCGE (P47662) Hypothetical protein MG423| Length = 561 Score = 27.7 bits (60), Expect = 8.3 Identities = 13/37 (35%), Positives = 24/37 (64%) Frame = +2 Query: 110 INTQGGWLQSRSSYSVLSDKNIAADMASQLGEVVDEL 220 +NT G++ + VL+DKNIA + +QL +++ +L Sbjct: 151 LNTDNGYIVFIDDFIVLNDKNIAFE--NQLNQIIPKL 185
>Y493_HAEIN (O05023) Hypothetical transposase-like protein HI0493| Length = 118 Score = 27.7 bits (60), Expect = 8.3 Identities = 16/52 (30%), Positives = 24/52 (46%) Frame = +2 Query: 59 RTPATKNGKTLEETAPIINTQGGWLQSRSSYSVLSDKNIAADMASQLGEVVD 214 RT TK K L+ PI+++ GWL Y + +N S+ G +D Sbjct: 23 RTQPTK--KDLKTQNPILHSDQGWLYQMVGYQAILRENSIQQNMSRKGNYLD 72 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 30,726,608 Number of Sequences: 219361 Number of extensions: 486584 Number of successful extensions: 1531 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1515 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1531 length of database: 80,573,946 effective HSP length: 52 effective length of database: 69,167,174 effective search space used: 1660012176 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)