| Clone Name | rbaet01f02 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | YMV2_CAEEL (P34504) Hypothetical protein K04H4.2 precursor | 30 | 2.3 |
|---|
>YMV2_CAEEL (P34504) Hypothetical protein K04H4.2 precursor| Length = 967 Score = 29.6 bits (65), Expect = 2.3 Identities = 15/42 (35%), Positives = 22/42 (52%), Gaps = 4/42 (9%) Frame = -2 Query: 127 FMCDDEKPSSAGCVGG----GFIPCYAGLCCSETQGRERFID 14 F+C D ++ GCV G G+ C GLCC+ T + +D Sbjct: 487 FVCPDGTQAAGGCVNGQCGTGY-TCSNGLCCAGTSTTVKCLD 527 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 33,191,286 Number of Sequences: 219361 Number of extensions: 618211 Number of successful extensions: 1694 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 1674 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1694 length of database: 80,573,946 effective HSP length: 40 effective length of database: 71,799,506 effective search space used: 1723188144 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)