| Clone Name | bastl56h02 |
|---|---|
| Clone Library Name | barley_pub |
>HAT2_USTMA (Q4P553) Histone acetyltransferase type B subunit 2 (EC 2.3.1.48)| Length = 485 Score = 32.0 bits (71), Expect = 0.73 Identities = 14/29 (48%), Positives = 17/29 (58%) Frame = +3 Query: 78 DGGPELLFVRGDHFRAPSEKT*PWPPHWE 164 DG PEL+FV G H P++ W PH E Sbjct: 424 DGPPELIFVHGGHTSRPTDLA--WSPHME 450
>AXN1_MOUSE (O35625) Axin-1 (Axis inhibition protein 1) (Fused protein)| Length = 863 Score = 31.6 bits (70), Expect = 0.95 Identities = 16/46 (34%), Positives = 28/46 (60%), Gaps = 1/46 (2%) Frame = -2 Query: 388 FVKLTLYCSFSFSDFESPKLCS-RNCCAILGSGLKPNVPWRNEEEE 254 F+K +Y ++ + ESPK+CS ++ + G G+ +P NE+EE Sbjct: 201 FLKSDIYLEYTRTGSESPKVCSDQSSGSGTGKGMSGYLPTLNEDEE 246
>AXN1_RAT (O70239) Axin-1 (Axis inhibition protein 1) (rAxin)| Length = 827 Score = 31.6 bits (70), Expect = 0.95 Identities = 16/46 (34%), Positives = 28/46 (60%), Gaps = 1/46 (2%) Frame = -2 Query: 388 FVKLTLYCSFSFSDFESPKLCS-RNCCAILGSGLKPNVPWRNEEEE 254 F+K +Y ++ + ESPK+CS ++ + G G+ +P NE+EE Sbjct: 201 FLKSDIYLEYTRTGSESPKVCSDQSSGSGTGKGMSGYLPTLNEDEE 246
>AXN1_HUMAN (O15169) Axin-1 (Axis inhibition protein 1) (hAxin)| Length = 862 Score = 31.6 bits (70), Expect = 0.95 Identities = 16/46 (34%), Positives = 28/46 (60%), Gaps = 1/46 (2%) Frame = -2 Query: 388 FVKLTLYCSFSFSDFESPKLCS-RNCCAILGSGLKPNVPWRNEEEE 254 F+K +Y ++ + ESPK+CS ++ + G G+ +P NE+EE Sbjct: 201 FLKSDIYLEYTRTGSESPKVCSDQSSGSGTGKGISGYLPTLNEDEE 246
>RAVR1_HUMAN (Q8IY67) Protein raver-1| Length = 606 Score = 30.0 bits (66), Expect = 2.8 Identities = 14/31 (45%), Positives = 16/31 (51%) Frame = -3 Query: 105 GQRAAPDRRPPVLQYLPEPASLGSRGEGRKG 13 G R A PP Q P PA +G RG G +G Sbjct: 448 GDREALGLGPPAAQLTPPPAPVGLRGSGLRG 478
>MILK1_HUMAN (Q8N3F8) Molecule interacting with Rab13 (MIRab13) (MICAL-like| protein 1) Length = 863 Score = 28.5 bits (62), Expect = 8.1 Identities = 19/63 (30%), Positives = 29/63 (46%), Gaps = 3/63 (4%) Frame = -3 Query: 195 PLTP*LVATHLPNVEAKVMSFQMEP*SDLHGQRAAPDRRPPVLQY---LPEPASLGSRGE 25 P+ P P ++ KV + Q P D+HG+ +RR L++ L E G E Sbjct: 656 PVRPPAPGHGFPLIKRKVQADQYIPEEDIHGEMDTIERRLDALEHRGVLLEEKLRGGLNE 715 Query: 24 GRK 16 GR+ Sbjct: 716 GRE 718
>LYS4_CANGA (Q6FM51) Homoaconitase, mitochondrial precursor (EC 4.2.1.36)| (Homoaconitate hydratase) Length = 689 Score = 28.5 bits (62), Expect = 8.1 Identities = 14/38 (36%), Positives = 22/38 (57%) Frame = +3 Query: 336 GDSKSEKENEQYSVNFTKGGLLGPDNGLLRRPAHVISH 449 G + +EK +QYSV G + + + +PAHV+SH Sbjct: 17 GQNLTEKIVQQYSVGLAPGKRVHSGDYVSIKPAHVMSH 54 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 57,966,255 Number of Sequences: 219361 Number of extensions: 1122690 Number of successful extensions: 3025 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 2915 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3025 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2735358828 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)