| Clone Name | bastl55f09 |
|---|---|
| Clone Library Name | barley_pub |
>SND1_BRARE (Q7ZT42) Staphylococcal nuclease domain-containing protein 1 (p100| co-activator) (100 kDa coactivator) (4SNc-Tudor domain protein) Length = 897 Score = 37.4 bits (85), Expect = 0.010 Identities = 20/53 (37%), Positives = 28/53 (52%) Frame = +2 Query: 137 IMASNTGASGWLRGKVKAVTSGDCLLIMGSTKAEIPPEKSITLSYLMAPRLAR 295 + +S A RG VK V SG +++ G + PPE+ I LS + A LAR Sbjct: 9 VQSSQASAPQLQRGIVKMVLSGCAIIVRGQPRGGPPPERQINLSNIRAGALAR 61
>SND1_MOUSE (Q78PY7) Staphylococcal nuclease domain-containing protein 1 (p100| co-activator) (100 kDa coactivator) Length = 910 Score = 37.0 bits (84), Expect = 0.013 Identities = 23/60 (38%), Positives = 32/60 (53%), Gaps = 6/60 (10%) Frame = +2 Query: 134 AIMASNTGASGW------LRGKVKAVTSGDCLLIMGSTKAEIPPEKSITLSYLMAPRLAR 295 A A ++G+SG RG VK V SG +++ G + PPE+ I LS + A LAR Sbjct: 2 ASSAQSSGSSGGPAVPTVQRGIVKMVLSGCAIIVRGQPRGGPPPERQINLSNIRAGNLAR 61
>SND1_RAT (Q66X93) Staphylococcal nuclease domain-containing protein 1 (p100| co-activator) (100 kDa coactivator) (SND p102) (p105 coactivator) Length = 909 Score = 36.6 bits (83), Expect = 0.017 Identities = 22/57 (38%), Positives = 31/57 (54%), Gaps = 6/57 (10%) Frame = +2 Query: 143 ASNTGASGW------LRGKVKAVTSGDCLLIMGSTKAEIPPEKSITLSYLMAPRLAR 295 A ++G+SG RG VK V SG +++ G + PPE+ I LS + A LAR Sbjct: 4 AQSSGSSGGPAVPTVQRGIVKMVLSGCAIIVRGQPRGGPPPERQINLSNIRAGNLAR 60
>SND1_BOVIN (Q863B3) Staphylococcal nuclease domain-containing protein 1 (p100| co-activator) (100 kDa coactivator) Length = 910 Score = 35.8 bits (81), Expect = 0.028 Identities = 18/41 (43%), Positives = 24/41 (58%) Frame = +2 Query: 173 RGKVKAVTSGDCLLIMGSTKAEIPPEKSITLSYLMAPRLAR 295 RG VK V SG +++ G + PPE+ I LS + A LAR Sbjct: 21 RGIVKMVLSGCAIIVRGQPRGGPPPERQINLSNIRAGNLAR 61
>SND1_HUMAN (Q7KZF4) Staphylococcal nuclease domain-containing protein 1 (p100| co-activator) (100 kDa coactivator) (EBNA2 coactivator p100) Length = 910 Score = 35.4 bits (80), Expect = 0.037 Identities = 17/41 (41%), Positives = 24/41 (58%) Frame = +2 Query: 173 RGKVKAVTSGDCLLIMGSTKAEIPPEKSITLSYLMAPRLAR 295 RG +K V SG +++ G + PPE+ I LS + A LAR Sbjct: 21 RGIIKMVLSGCAIIVRGQPRGGPPPERQINLSNIRAGNLAR 61
>HISX_BRAJA (P59397) Histidinol dehydrogenase (EC 1.1.1.23) (HDH)| Length = 431 Score = 29.6 bits (65), Expect = 2.0 Identities = 18/65 (27%), Positives = 30/65 (46%), Gaps = 4/65 (6%) Frame = +2 Query: 110 LAAGQSQGAIMASNTGASGWLRGKVKAV----TSGDCLLIMGSTKAEIPPEKSITLSYLM 277 + AG S+ ++A +TG + W+ + A TS +LI S + EK++ Sbjct: 232 MIAGPSEVLVIADDTGNADWIAADLLAQAEHDTSAQSILITDSARLAADVEKAVEAQLKT 291 Query: 278 APRLA 292 PR A Sbjct: 292 LPRTA 296
>HCN4_RABIT (Q9TV66) Potassium/sodium hyperpolarization-activated cyclic| nucleotide-gated channel 4 (Hyperpolarization-activated cation channel 4) (HAC-4) Length = 1175 Score = 28.9 bits (63), Expect = 3.5 Identities = 16/40 (40%), Positives = 21/40 (52%), Gaps = 2/40 (5%) Frame = +2 Query: 113 AAG--QSQGAIMASNTGASGWLRGKVKAVTSGDCLLIMGS 226 AAG +S+GA + G RG K+ T+GDC GS Sbjct: 66 AAGGAESRGAALGGAADGEGPARGAAKSSTNGDCRRFRGS 105
>MYCB2_MOUSE (Q7TPH6) Probable ubiquitin ligase protein MYCBP2 (EC 6.3.2.-) (Myc| binding protein 2) (Protein associated with Myc) (Pam/highwire/rpm-1 protein) Length = 4711 Score = 27.7 bits (60), Expect = 7.8 Identities = 12/31 (38%), Positives = 20/31 (64%), Gaps = 1/31 (3%) Frame = -3 Query: 111 SGLRLPIRDPGEGVWPAG*SLLS-RPDPDPN 22 +GL + ++DP +G+ P G L+ + DP PN Sbjct: 2393 AGLEVKVKDPPKGMIPPGTQLVKPKADPQPN 2423 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 40,381,374 Number of Sequences: 219361 Number of extensions: 715970 Number of successful extensions: 2055 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 2034 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2055 length of database: 80,573,946 effective HSP length: 74 effective length of database: 64,341,232 effective search space used: 1544189568 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)