| Clone Name | bastl55e11 |
|---|---|
| Clone Library Name | barley_pub |
>PSD2_MOUSE (Q8VDM4) 26S proteasome non-ATPase regulatory subunit 2 (26S| proteasome regulatory subunit RPN1) (26S proteasome regulatory subunit S2) (26S proteasome subunit p97) Length = 908 Score = 41.2 bits (95), Expect = 6e-04 Identities = 20/39 (51%), Positives = 29/39 (74%) Frame = +1 Query: 295 QLELYVVRAQDVDPGVQRLALESMRQEIRSATSSMTSVP 411 +LE+ V R + D + R ALE +R++IRS+T+SMTSVP Sbjct: 55 ELEMLVERLGEKDTSLYRPALEELRRQIRSSTTSMTSVP 93
>PSD2_HUMAN (Q13200) 26S proteasome non-ATPase regulatory subunit 2 (26S| proteasome regulatory subunit RPN1) (26S proteasome regulatory subunit S2) (26S proteasome subunit p97) (Tumor necrosis factor type 1 receptor-associated protein 2) (55.11 protein) Length = 908 Score = 41.2 bits (95), Expect = 6e-04 Identities = 20/39 (51%), Positives = 29/39 (74%) Frame = +1 Query: 295 QLELYVVRAQDVDPGVQRLALESMRQEIRSATSSMTSVP 411 +LE+ V R + D + R ALE +R++IRS+T+SMTSVP Sbjct: 55 ELEMLVERLGEKDTSLYRPALEELRRQIRSSTTSMTSVP 93
>RPN1_YEAST (P38764) 26S proteasome regulatory subunit RPN1 (Proteasome| non-ATPase subunit 1) Length = 992 Score = 34.3 bits (77), Expect = 0.072 Identities = 15/38 (39%), Positives = 27/38 (71%) Frame = +1 Query: 298 LELYVVRAQDVDPGVQRLALESMRQEIRSATSSMTSVP 411 LEL V R ++ D + +L ++++ I+++TSSMT+VP Sbjct: 48 LELLVERLKEDDSSLYEASLNALKESIKNSTSSMTAVP 85
>RPN1_SCHPO (P87048) 26S proteasome regulatory subunit rpn1 (Proteasome| non-ATPase subunit mts4) (19S regulatory cap region of 26S protease subunit 2) Length = 891 Score = 33.9 bits (76), Expect = 0.094 Identities = 17/38 (44%), Positives = 25/38 (65%) Frame = +1 Query: 298 LELYVVRAQDVDPGVQRLALESMRQEIRSATSSMTSVP 411 LEL V QD P + +L +++ IR++TSSMT+VP Sbjct: 57 LELLVQAVQDATPELVGSSLTQLKEIIRTSTSSMTAVP 94
>RPN1_NEUCR (Q7S8R8) 26S proteasome regulatory subunit rpn-1| Length = 883 Score = 32.0 bits (71), Expect = 0.36 Identities = 14/30 (46%), Positives = 23/30 (76%) Frame = +1 Query: 322 QDVDPGVQRLALESMRQEIRSATSSMTSVP 411 Q+ D + + ALE+M+ I+++TSSMT+VP Sbjct: 48 QESDATLYKPALEAMKNSIKTSTSSMTAVP 77
>PCY2_RAT (O88637) Ethanolamine-phosphate cytidylyltransferase (EC 2.7.7.14)| (Phosphorylethanolamine transferase) (CTP:phosphoethanolamine cytidylyltransferase) Length = 404 Score = 30.4 bits (67), Expect = 1.0 Identities = 14/30 (46%), Positives = 16/30 (53%) Frame = -1 Query: 121 IRFGDGAGGLARVRGASGTEATRCCCVGVY 32 IR G GAGG A ++G G R C G Y Sbjct: 2 IRNGHGAGGAAGLKGPGGQRTVRVWCDGCY 31
>BAT2_RAT (Q6MG48) Large proline-rich protein BAT2 (HLA-B-associated transcript| 2) Length = 2161 Score = 29.6 bits (65), Expect = 1.8 Identities = 13/31 (41%), Positives = 19/31 (61%) Frame = +3 Query: 39 PTQQHRVASVPLAPRTLASPPAPSPNRIRPA 131 P ++ +A VPLAP +PP+P+P R A Sbjct: 1129 PPKEGVLAQVPLAPPQPGAPPSPAPARFSTA 1159
>YKY4_CAEEL (Q17963) Hypothetical WD-repeat protein C14B1.4| Length = 376 Score = 28.9 bits (63), Expect = 3.0 Identities = 17/34 (50%), Positives = 21/34 (61%), Gaps = 2/34 (5%) Frame = +3 Query: 39 PTQQHRVASVPLAPRTLASPPAP--SPNRIRPAS 134 PTQQ +VP AP +S PAP SPN I P++ Sbjct: 15 PTQQIDQLTVPNAPDGGSSAPAPSTSPNSISPSN 48
>DYNA_MOUSE (O08788) Dynactin-1 (150 kDa dynein-associated polypeptide)| (DP-150) (DAP-150) (p150-glued) Length = 1281 Score = 28.5 bits (62), Expect = 4.0 Identities = 13/32 (40%), Positives = 19/32 (59%) Frame = +2 Query: 8 SKAEILQKINPHAAAPSRLRTTRPPNPSQPAS 103 +K L+ + P A +R TTR P P++PAS Sbjct: 126 AKTSKLRGLKPKKAPTARKTTTRRPKPTRPAS 157
>ELL2_HUMAN (O00472) RNA polymerase II elongation factor ELL2| Length = 640 Score = 28.5 bits (62), Expect = 4.0 Identities = 14/34 (41%), Positives = 17/34 (50%), Gaps = 1/34 (2%) Frame = +3 Query: 39 PTQQHRVASVPLAPRTLASP-PAPSPNRIRPASH 137 PT + A +PL P A P P P P+ P SH Sbjct: 354 PTSEKSAAGLPLPPAAAAIPTPPPLPSTYLPISH 387
>DYNA_RAT (P28023) Dynactin-1 (150 kDa dynein-associated polypeptide)| (DP-150) (DAP-150) (p150-glued) Length = 1280 Score = 28.5 bits (62), Expect = 4.0 Identities = 13/32 (40%), Positives = 19/32 (59%) Frame = +2 Query: 8 SKAEILQKINPHAAAPSRLRTTRPPNPSQPAS 103 +K L+ + P A +R TTR P P++PAS Sbjct: 126 AKTSKLRGLKPKKAPTARKTTTRRPKPTRPAS 157
>DYNA_HUMAN (Q14203) Dynactin-1 (150 kDa dynein-associated polypeptide)| (DP-150) (DAP-150) (p150-glued) (p135) Length = 1278 Score = 28.5 bits (62), Expect = 4.0 Identities = 13/32 (40%), Positives = 19/32 (59%) Frame = +2 Query: 8 SKAEILQKINPHAAAPSRLRTTRPPNPSQPAS 103 +K L+ + P A +R TTR P P++PAS Sbjct: 126 AKTSKLRGLKPKKAPTARKTTTRRPKPTRPAS 157
>BAT2_MOUSE (Q7TSC1) Large proline-rich protein BAT2 (HLA-B-associated transcript| 2) Length = 2158 Score = 28.1 bits (61), Expect = 5.2 Identities = 12/31 (38%), Positives = 18/31 (58%) Frame = +3 Query: 39 PTQQHRVASVPLAPRTLASPPAPSPNRIRPA 131 P ++ + VPLAP +PP+P+P R A Sbjct: 1124 PPKEGVLGQVPLAPPQPGAPPSPAPARFSTA 1154
>BAT2_MACMU (Q5TM26) Large proline-rich protein BAT2 (HLA-B-associated transcript| 2) Length = 2160 Score = 28.1 bits (61), Expect = 5.2 Identities = 11/27 (40%), Positives = 17/27 (62%) Frame = +3 Query: 39 PTQQHRVASVPLAPRTLASPPAPSPNR 119 P ++ + VPLAP +PP+P+P R Sbjct: 1129 PPKEGTLTQVPLAPPPPGAPPSPAPAR 1155
>YK57_YEAST (P36157) Hypothetical 39.9 kDa protein in SIS2-MTD1 intergenic| region Length = 363 Score = 27.7 bits (60), Expect = 6.8 Identities = 13/33 (39%), Positives = 18/33 (54%) Frame = +3 Query: 36 TPTQQHRVASVPLAPRTLASPPAPSPNRIRPAS 134 TP QQ R +S P + TL P +P+ P+S Sbjct: 5 TPQQQQRFSSTPQSSHTLIFSPIRAPSMQTPSS 37
>BORG5_HUMAN (Q00587) Cdc42 effector protein 1 (Binder of Rho GTPases 5) (Serum| protein MSE55) Length = 391 Score = 27.3 bits (59), Expect = 8.8 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 57 VASVPLAPRTLASPPAPSP 113 V V PR +ASPPAPSP Sbjct: 89 VRRVGAPPRRMASPPAPSP 107
>CHS4_NEUCR (Q01285) Chitin synthase 4 (EC 2.4.1.16) (Chitin-UDP| acetyl-glucosaminyl transferase 4) (Class-IV chitin synthase 4) Length = 1195 Score = 27.3 bits (59), Expect = 8.8 Identities = 13/26 (50%), Positives = 17/26 (65%) Frame = +3 Query: 39 PTQQHRVASVPLAPRTLASPPAPSPN 116 P+QQ RV S+ P TL P+P+PN Sbjct: 6 PSQQQRVPSISSFPETL---PSPNPN 28
>YACF_SALTY (P67693) UPF0289 protein yacF| Length = 247 Score = 27.3 bits (59), Expect = 8.8 Identities = 11/26 (42%), Positives = 19/26 (73%) Frame = +1 Query: 334 PGVQRLALESMRQEIRSATSSMTSVP 411 PGV + +E++RQ+++SA S + S P Sbjct: 81 PGVDQDRIEALRQQLKSAGSVLISAP 106
>YACF_SALTI (P67694) UPF0289 protein yacF| Length = 247 Score = 27.3 bits (59), Expect = 8.8 Identities = 11/26 (42%), Positives = 19/26 (73%) Frame = +1 Query: 334 PGVQRLALESMRQEIRSATSSMTSVP 411 PGV + +E++RQ+++SA S + S P Sbjct: 81 PGVDQDRIEALRQQLKSAGSVLISAP 106
>YACF_SALPA (Q5PDD7) UPF0289 protein yacF| Length = 247 Score = 27.3 bits (59), Expect = 8.8 Identities = 11/26 (42%), Positives = 19/26 (73%) Frame = +1 Query: 334 PGVQRLALESMRQEIRSATSSMTSVP 411 PGV + +E++RQ+++SA S + S P Sbjct: 81 PGVDQDRIEALRQQLKSAGSVLISAP 106 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.306 0.125 0.345 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 31,935,464 Number of Sequences: 219361 Number of extensions: 346174 Number of successful extensions: 1091 Number of sequences better than 10.0: 20 Number of HSP's better than 10.0 without gapping: 1031 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1090 length of database: 80,573,946 effective HSP length: 112 effective length of database: 56,005,514 effective search space used: 1344132336 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 43 (22.0 bits)