| Clone Name | bastl54c10 |
|---|---|
| Clone Library Name | barley_pub |
>BGAL_MALDO (P48981) Beta-galactosidase precursor (EC 3.2.1.23) (Lactase) (Acid| beta-galactosidase) (Exo-(1-->4)-beta-D-galactanase) Length = 731 Score = 62.8 bits (151), Expect = 3e-10 Identities = 23/39 (58%), Positives = 36/39 (92%) Frame = +1 Query: 301 TSAATNVTYDHRALVIDGVRRVLVSGSIHYPRSTPDTWP 417 ++A+ +V+YDH+A++I+G +R+L+SGSIHYPRSTP+ WP Sbjct: 20 SAASASVSYDHKAIIINGQKRILISGSIHYPRSTPEMWP 58
>BGAL_ASPOF (P45582) Beta-galactosidase precursor (EC 3.2.1.23) (Lactase)| Length = 832 Score = 61.6 bits (148), Expect = 7e-10 Identities = 23/38 (60%), Positives = 33/38 (86%) Frame = +1 Query: 304 SAATNVTYDHRALVIDGVRRVLVSGSIHYPRSTPDTWP 417 + +VTYDH++++I+G RR+L+SGSIHYPRSTP+ WP Sbjct: 22 AVTASVTYDHKSVIINGQRRILISGSIHYPRSTPEMWP 59
>BGAL_LYCES (P48980) Beta-galactosidase precursor (EC 3.2.1.23) (Lactase) (Acid| beta-galactosidase) (Exo-(1-->4)-beta-D-galactanase) Length = 835 Score = 59.7 bits (143), Expect = 3e-09 Identities = 21/34 (61%), Positives = 32/34 (94%) Frame = +1 Query: 316 NVTYDHRALVIDGVRRVLVSGSIHYPRSTPDTWP 417 +V+YDH+A++++G R++L+SGSIHYPRSTP+ WP Sbjct: 23 SVSYDHKAIIVNGQRKILISGSIHYPRSTPEMWP 56
>BGAL_BRAOL (P49676) Beta-galactosidase precursor (EC 3.2.1.23) (Lactase)| Length = 828 Score = 58.9 bits (141), Expect = 5e-09 Identities = 25/40 (62%), Positives = 33/40 (82%) Frame = +1 Query: 298 GTSAATNVTYDHRALVIDGVRRVLVSGSIHYPRSTPDTWP 417 G++ +T V++D RA+ IDG RR+L+SGSIHYPRST D WP Sbjct: 20 GSANSTIVSHDERAITIDGQRRILLSGSIHYPRSTSDMWP 59
>BGAL_DIACA (Q00662) Putative beta-galactosidase precursor (EC 3.2.1.23)| (Lactase) (SR12 protein) Length = 731 Score = 55.5 bits (132), Expect = 5e-08 Identities = 23/34 (67%), Positives = 29/34 (85%) Frame = +1 Query: 316 NVTYDHRALVIDGVRRVLVSGSIHYPRSTPDTWP 417 NV YD+RA+ I+ RR+L+SGSIHYPRSTP+ WP Sbjct: 30 NVWYDYRAIKINDQRRILLSGSIHYPRSTPEMWP 63
>TTGH_PSEPU (Q93PU4) Toluene efflux pump membrane transporter ttgH| Length = 1049 Score = 28.1 bits (61), Expect = 8.8 Identities = 14/29 (48%), Positives = 19/29 (65%) Frame = -1 Query: 223 RSPEKKQRQGLHLVRGMMAFGVLAELVAR 137 R PE+ QRQGL +V+ M F ++ LV R Sbjct: 117 RLPEEVQRQGLRVVKYQMNFFLVMSLVDR 145
>SRPB_PSEPU (O31100) Solvent resistant pump membrane transporter srpB| Length = 1049 Score = 28.1 bits (61), Expect = 8.8 Identities = 14/29 (48%), Positives = 19/29 (65%) Frame = -1 Query: 223 RSPEKKQRQGLHLVRGMMAFGVLAELVAR 137 R PE+ QRQGL +V+ M F ++ LV R Sbjct: 117 RLPEEVQRQGLRVVKYQMNFFLVMSLVDR 145 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.313 0.126 0.365 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 31,963,269 Number of Sequences: 219361 Number of extensions: 337310 Number of successful extensions: 838 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 823 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 838 length of database: 80,573,946 effective HSP length: 100 effective length of database: 58,637,846 effective search space used: 2286875994 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits)