| Clone Name | bastl54a09 |
|---|---|
| Clone Library Name | barley_pub |
>UBP7_HUMAN (Q93009) Ubiquitin carboxyl-terminal hydrolase 7 (EC 3.1.2.15)| (Ubiquitin thioesterase 7) (Ubiquitin-specific-processing protease 7) (Deubiquitinating enzyme 7) (Herpesvirus-associated ubiquitin-specific protease) Length = 1102 Score = 118 bits (296), Expect = 6e-27 Identities = 63/133 (47%), Positives = 85/133 (63%) Frame = +3 Query: 63 WTRYAQFSLSVVNQIHNKFTIRKETQHQFSARESDWGFTSFMPLSELYNPSRGYLVNDTC 242 W+ +AQ L ++N ++ + + H F +E+DWGF++FM SE+ +P +G++ +D Sbjct: 130 WSCHAQAVLKIINYRDDEKSFSRRISHLFFHKENDWGFSNFMAWSEVTDPEKGFIDDDKV 189 Query: 243 VIEAEVAVCKVVDYWSYDSKKETGYVGLKNQGATCYMNSLLQTLYHIPYFRKAVYHMPTT 422 E V ++DSKK TGYVGLKNQGATCYMNSLLQTL+ RKAVY MP T Sbjct: 190 TFEVFVQA-DAPHGVAWDSKKHTGYVGLKNQGATCYMNSLLQTLFFTNQLRKAVYMMP-T 247 Query: 423 ENDMPSGSIPLAL 461 E D S S+PLAL Sbjct: 248 EGDDSSKSVPLAL 260
>UBP15_YEAST (P50101) Ubiquitin carboxyl-terminal hydrolase 15 (EC 3.1.2.15)| (Ubiquitin thioesterase 15) (Ubiquitin-specific-processing protease 15) (Deubiquitinating enzyme 15) Length = 1230 Score = 108 bits (269), Expect = 9e-24 Identities = 62/145 (42%), Positives = 92/145 (63%), Gaps = 12/145 (8%) Frame = +3 Query: 63 WTRYAQFSLSVVNQIHNKFTIR--KETQHQFSARESDWGFTSFMPLSELYNPSRG----Y 224 W AQF++ + ++ N TI ++ H+F+A ++DWGF + + L+ L +PS+G + Sbjct: 109 WYCCAQFAIGI-SRPGNGDTINLINKSHHRFNALDTDWGFANLIDLNNLKHPSKGRPLSF 167 Query: 225 LVNDTCVIEAEVAVCKVV------DYWSYDSKKETGYVGLKNQGATCYMNSLLQTLYHIP 386 L T I A V + K ++ +YDSKK TGYVG +NQGATCY+NSLLQ+ + Sbjct: 168 LNEGTLNITAYVRILKDPTGVLWHNFLNYDSKKVTGYVGFRNQGATCYLNSLLQSYFFTK 227 Query: 387 YFRKAVYHMPTTENDMPSGSIPLAL 461 YFRK VY +P TE++ P+ S+PLAL Sbjct: 228 YFRKLVYEIP-TEHESPNNSVPLAL 251
>UBP21_SCHPO (Q9UTT1) Ubiquitin carboxyl-terminal hydrolase 21 (EC 3.1.2.15)| (Ubiquitin thioesterase 21) (Ubiquitin-specific processing protease 21) (Deubiquitinating enzyme 21) Length = 1129 Score = 97.8 bits (242), Expect = 1e-20 Identities = 60/139 (43%), Positives = 79/139 (56%), Gaps = 10/139 (7%) Frame = +3 Query: 75 AQFSLSVVNQIHNKFTIRKETQHQFSARESDWGFTSFMPLSELYNPSRGY----LVNDTC 242 AQF+LS+ N + H+F + DWGFT F+ L ++ P+ + L ND Sbjct: 139 AQFALSLSNVQDPTVMQINTSHHRFRSEVKDWGFTRFVDLRKIAVPTPEFPVPFLENDEI 198 Query: 243 VIEAEVAVCKVV------DYWSYDSKKETGYVGLKNQGATCYMNSLLQTLYHIPYFRKAV 404 I V V + + +Y+SKKETGYVGLKNQGATCYMNSLLQ+L+ FRK V Sbjct: 199 CISVTVRVLQDPTGVLWHSFVNYNSKKETGYVGLKNQGATCYMNSLLQSLFFTNIFRKTV 258 Query: 405 YHMPTTENDMPSGSIPLAL 461 Y +P T+ND S+ AL Sbjct: 259 YKIP-TDNDDSRDSVAYAL 276
>UBP5_SCHPO (Q09879) Probable ubiquitin carboxyl-terminal hydrolase 5 (EC| 3.1.2.15) (Ubiquitin thioesterase 5) (Ubiquitin-specific processing protease 5) (Deubiquitinating enzyme 5) Length = 1108 Score = 85.5 bits (210), Expect = 6e-17 Identities = 56/137 (40%), Positives = 71/137 (51%), Gaps = 10/137 (7%) Frame = +3 Query: 78 QFSLSVVNQIHNKFTIRKETQHQFSARESDWGFTSFMPLSELY---NPSRGYLVND-TCV 245 QF+ + N ++ +FS DWGFT F L +L P +V D + Sbjct: 123 QFAFVISNPRKPSLSVANSAHCRFSPEIVDWGFTQFAELKKLLCRQAPDVPPIVEDGALL 182 Query: 246 IEAEVAVCKVV------DYWSYDSKKETGYVGLKNQGATCYMNSLLQTLYHIPYFRKAVY 407 + A V + K + YDSK TGYVGLKNQGATCYMNSLLQ+LY I FR+ VY Sbjct: 183 LTAYVRILKDPTGVLWHSFNDYDSKIATGYVGLKNQGATCYMNSLLQSLYIIHAFRRIVY 242 Query: 408 HMPTTENDMPSGSIPLA 458 +PT D P G +A Sbjct: 243 QIPT---DSPQGKDSIA 256
>UBP47_HUMAN (Q96K76) Ubiquitin carboxyl-terminal hydrolase 47 (EC 3.1.2.15)| (Ubiquitin thioesterase 47) (Ubiquitin-specific-processing protease 47) (Deubiquitinating enzyme 47) Length = 1375 Score = 60.8 bits (146), Expect = 2e-09 Identities = 34/67 (50%), Positives = 41/67 (61%), Gaps = 1/67 (1%) Frame = +3 Query: 264 VCKVVDYWSYDSKKETGYVGLKNQGATCYMNSLLQTLYHIPYFRKAVYHMPTTENDM-PS 440 V + Y S +K ETGYVGL NQ TCY+NSLLQTL+ P FR A+Y E++ P Sbjct: 170 VSQSYSYSSILNKSETGYVGLVNQAMTCYLNSLLQTLFMTPEFRNALYKWEFEESEEDPV 229 Query: 441 GSIPLAL 461 SIP L Sbjct: 230 TSIPYQL 236
>UBP47_MOUSE (Q8BY87) Ubiquitin carboxyl-terminal hydrolase 47 (EC 3.1.2.15)| (Ubiquitin thioesterase 47) (Ubiquitin-specific-processing protease 47) (Deubiquitinating enzyme 47) Length = 1376 Score = 60.1 bits (144), Expect = 3e-09 Identities = 38/83 (45%), Positives = 45/83 (54%), Gaps = 2/83 (2%) Frame = +3 Query: 219 GYLVNDTCVIEAEVAVCKVVDYWSYDSKKETGYVGLKNQGATCYMNSLLQTLYHIPYFRK 398 G L + V V + Y S +K ETGYVGL NQ TCY+NSLLQTL+ P FR Sbjct: 155 GPLPREGSVASTNDYVSQNYSYSSILNKSETGYVGLVNQAMTCYLNSLLQTLFMTPEFRN 214 Query: 399 AVY--HMPTTENDMPSGSIPLAL 461 A+Y +E D P SIP L Sbjct: 215 ALYKWEFEDSEED-PVTSIPYQL 236
>USP9Y_HUMAN (O00507) Probable ubiquitin carboxyl-terminal hydrolase FAF-Y (EC| 3.1.2.15) (Ubiquitin thioesterase FAF-Y) (Ubiquitin-specific-processing protease FAF-Y) (Deubiquitinating enzyme FAF-Y) (Fat facets protein-related, Y-linked) (Ubiquitin-specif Length = 2555 Score = 55.1 bits (131), Expect = 9e-08 Identities = 25/63 (39%), Positives = 37/63 (58%), Gaps = 4/63 (6%) Frame = +3 Query: 258 VAVCKVVDYWSY----DSKKETGYVGLKNQGATCYMNSLLQTLYHIPYFRKAVYHMPTTE 425 + C+ + W Y + G+VGLKN GATCYMNS++Q LY IP R ++ + T Sbjct: 1535 ITTCEALTEWEYLPPVGPRPPKGFVGLKNAGATCYMNSVIQQLYMIPSIRNSILAIEGTG 1594 Query: 426 NDM 434 +D+ Sbjct: 1595 SDL 1597
>USP9X_MOUSE (P70398) Probable ubiquitin carboxyl-terminal hydrolase FAF-X (EC| 3.1.2.15) (Ubiquitin thioesterase FAF-X) (Ubiquitin-specific-processing protease FAF-X) (Deubiquitinating enzyme FAF-X) (Fat facets protein-related, X-linked) (Ubiquitin-specif Length = 2559 Score = 54.7 bits (130), Expect = 1e-07 Identities = 26/67 (38%), Positives = 37/67 (55%), Gaps = 4/67 (5%) Frame = +3 Query: 246 IEAEVAVCKVVDYWSY----DSKKETGYVGLKNQGATCYMNSLLQTLYHIPYFRKAVYHM 413 I + C+ + W Y + G+VGLKN GATCYMNS++Q LY IP R + + Sbjct: 1529 IGTAITTCEALTEWEYLPPVGPRPPKGFVGLKNAGATCYMNSVIQQLYMIPSIRNGILAI 1588 Query: 414 PTTENDM 434 T +D+ Sbjct: 1589 EGTGSDV 1595
>USP9X_HUMAN (Q93008) Probable ubiquitin carboxyl-terminal hydrolase FAF-X (EC| 3.1.2.15) (Ubiquitin thioesterase FAF-X) (Ubiquitin specific-processing protease FAF-X) (Deubiquitinating enzyme FAF-X) (Fat facets protein related, X-linked) (Ubiquitin-specif Length = 2547 Score = 54.7 bits (130), Expect = 1e-07 Identities = 26/67 (38%), Positives = 37/67 (55%), Gaps = 4/67 (5%) Frame = +3 Query: 246 IEAEVAVCKVVDYWSY----DSKKETGYVGLKNQGATCYMNSLLQTLYHIPYFRKAVYHM 413 I + C+ + W Y + G+VGLKN GATCYMNS++Q LY IP R + + Sbjct: 1522 IGTAITTCEALTEWEYLPPVGPRPPKGFVGLKNAGATCYMNSVIQQLYMIPSIRNGILAI 1581 Query: 414 PTTENDM 434 T +D+ Sbjct: 1582 EGTGSDV 1588
>UBPE_DROME (Q24574) Ubiquitin carboxyl-terminal hydrolase 64E (EC 3.1.2.15)| (Ubiquitin thioesterase 64E) (Ubiquitin-specific-processing protease 64E) (Deubiquitinating enzyme 64E) Length = 1556 Score = 51.2 bits (121), Expect = 1e-06 Identities = 26/50 (52%), Positives = 32/50 (64%) Frame = +3 Query: 312 GYVGLKNQGATCYMNSLLQTLYHIPYFRKAVYHMPTTENDMPSGSIPLAL 461 GYVGL NQ TCY+NSLLQ L+ P FR A+Y +ND + +IP L Sbjct: 394 GYVGLVNQAMTCYLNSLLQALFMTPEFRNALYRW-EFDNDNEAKNIPYQL 442
>UBP40_HUMAN (Q9NVE5) Ubiquitin carboxyl-terminal hydrolase 40 (EC 3.1.2.15)| (Ubiquitin thioesterase 40) (Ubiquitin-specific-processing protease 40) (Deubiquitinating enzyme 40) Length = 1235 Score = 47.4 bits (111), Expect = 2e-05 Identities = 20/39 (51%), Positives = 28/39 (71%) Frame = +3 Query: 309 TGYVGLKNQGATCYMNSLLQTLYHIPYFRKAVYHMPTTE 425 T G++NQG TCY+NSLLQTL+ P FR+A++ + E Sbjct: 38 TNLSGIRNQGGTCYLNSLLQTLHFTPEFREALFSLGPEE 76
>UBP24_HUMAN (Q9UPU5) Ubiquitin carboxyl-terminal hydrolase 24 (EC 3.1.2.15)| (Ubiquitin thioesterase 24) (Ubiquitin-specific-processing protease 24) (Deubiquitinating enzyme 24) Length = 1870 Score = 46.6 bits (109), Expect = 3e-05 Identities = 25/68 (36%), Positives = 40/68 (58%), Gaps = 1/68 (1%) Frame = +3 Query: 249 EAEVAVCKVVDYWS-YDSKKETGYVGLKNQGATCYMNSLLQTLYHIPYFRKAVYHMPTTE 425 + + A+ K DY DS+ +G+VGL+N GATCYMN++ Q LY P +++ + + Sbjct: 915 QPDPALTKEFDYLPPVDSRSSSGFVGLRNGGATCYMNAVFQQLYMQPGLPESLLSV-DDD 973 Query: 426 NDMPSGSI 449 D P S+ Sbjct: 974 TDNPDDSV 981
>FAF_DROME (P55824) Probable ubiquitin carboxyl-terminal hydrolase FAF (EC| 3.1.2.15) (Ubiquitin thioesterase FAF) (Ubiquitin specific-processing protease FAF) (Deubiquitinating enzyme FAF) (Protein fat facets) Length = 2778 Score = 46.6 bits (109), Expect = 3e-05 Identities = 26/64 (40%), Positives = 35/64 (54%), Gaps = 7/64 (10%) Frame = +3 Query: 285 WSY----DSKKETGYVGLKNQGATCYMNSLLQTLYHIPYFRKAV---YHMPTTENDMPSG 443 W Y ++ G+ GLKN GATCYMNS+LQ LY +P R + + TT+ + SG Sbjct: 1653 WDYLPPVGARPTKGFCGLKNAGATCYMNSVLQQLYMVPAVRVGILRAHGAATTDGEDFSG 1712 Query: 444 SIPL 455 L Sbjct: 1713 DSDL 1716
>UBP40_MOUSE (Q8BWR4) Ubiquitin carboxyl-terminal hydrolase 40 (EC 3.1.2.15)| (Ubiquitin thioesterase 40) (Ubiquitin-specific-processing protease 40) (Deubiquitinating enzyme 40) (Fragment) Length = 1140 Score = 45.4 bits (106), Expect = 7e-05 Identities = 19/39 (48%), Positives = 28/39 (71%) Frame = +3 Query: 309 TGYVGLKNQGATCYMNSLLQTLYHIPYFRKAVYHMPTTE 425 T G++NQG TCY++SLLQTL+ P FR+A++ + E Sbjct: 38 TNLSGIRNQGGTCYLSSLLQTLHFTPEFREALFSLGPEE 76
>UBP1_HUMAN (O94782) Ubiquitin carboxyl-terminal hydrolase 1 (EC 3.1.2.15)| (Ubiquitin thioesterase 1) (Ubiquitin-specific processing protease 1) (Deubiquitinating enzyme 1) (hUBP) Length = 785 Score = 43.9 bits (102), Expect = 2e-04 Identities = 18/33 (54%), Positives = 23/33 (69%) Frame = +3 Query: 315 YVGLKNQGATCYMNSLLQTLYHIPYFRKAVYHM 413 +VGL N G TCY+NS+LQ LY P F+ V H+ Sbjct: 80 FVGLNNLGNTCYLNSILQVLYFCPGFKSGVKHL 112
>UBP25_MOUSE (P57080) Ubiquitin carboxyl-terminal hydrolase 25 (EC 3.1.2.15)| (Ubiquitin thioesterase 25) (Ubiquitin-specific-processing protease 25) (Deubiquitinating enzyme 25) (mUSP25) Length = 1055 Score = 42.7 bits (99), Expect = 4e-04 Identities = 27/79 (34%), Positives = 44/79 (55%), Gaps = 14/79 (17%) Frame = +3 Query: 243 VIEAEVAVCKV------VDYWS-----YDSKK-ETGYVGLKNQGATCYMNSLLQTLYHIP 386 V+EA +A K ++ W YD K+ E VGLKN G TC+ ++++Q+L+++ Sbjct: 132 VLEASIAENKACLKRTPIEVWRDSRNPYDRKRQEKAPVGLKNVGNTCWFSAVIQSLFNLL 191 Query: 387 YFRKAV--YHMPTTENDMP 437 FR+ V Y P+ D+P Sbjct: 192 EFRRLVLNYKPPSNAQDLP 210
>UBP35_HUMAN (Q9P2H5) Ubiquitin carboxyl-terminal hydrolase 35 (EC 3.1.2.15)| (Ubiquitin thioesterase 35) (Ubiquitin-specific-processing protease 35) (Deubiquitinating enzyme 35) Length = 1017 Score = 42.7 bits (99), Expect = 4e-04 Identities = 21/47 (44%), Positives = 28/47 (59%) Frame = +3 Query: 297 SKKETGYVGLKNQGATCYMNSLLQTLYHIPYFRKAVYHMPTTENDMP 437 +K +TG +GL N G TCY+NS+LQ L+ FR V + T N P Sbjct: 433 AKSDTGKIGLINLGNTCYVNSILQALFMASEFRHCVLRL-TENNSQP 478
>UBP38_MOUSE (Q8BW70) Ubiquitin carboxyl-terminal hydrolase 38 (EC 3.1.2.15)| (Ubiquitin thioesterase 38) (Ubiquitin-specific-processing protease 38) (Deubiquitinating enzyme 38) Length = 1042 Score = 42.0 bits (97), Expect = 8e-04 Identities = 20/35 (57%), Positives = 23/35 (65%) Frame = +3 Query: 300 KKETGYVGLKNQGATCYMNSLLQTLYHIPYFRKAV 404 K ETG GL N G TCYMNS+LQ L+ FR+ V Sbjct: 439 KSETGKTGLINLGNTCYMNSVLQALFMATEFRRQV 473
>UBP49_MOUSE (Q6P9L4) Ubiquitin carboxyl-terminal hydrolase 49 (EC 3.1.2.15)| (Ubiquitin thioesterase 49) (Ubiquitin-specific-processing protease 49) (Deubiquitinating enzyme 49) Length = 685 Score = 41.6 bits (96), Expect = 0.001 Identities = 19/42 (45%), Positives = 27/42 (64%), Gaps = 1/42 (2%) Frame = +3 Query: 312 GYVGLKNQGATCYMNSLLQTLYHIPYFRKAVYHM-PTTENDM 434 G GL+N G TCYMNS+LQ L H+ FR+ ++ P+T + Sbjct: 248 GVTGLRNLGNTCYMNSILQVLSHLQKFRECFLNLDPSTSEHL 289
>UBP49_HUMAN (Q70CQ1) Ubiquitin carboxyl-terminal hydrolase 49 (EC 3.1.2.15)| (Ubiquitin thioesterase 49) (Ubiquitin-specific-processing protease 49) (Deubiquitinating enzyme 49) Length = 688 Score = 41.6 bits (96), Expect = 0.001 Identities = 17/40 (42%), Positives = 26/40 (65%) Frame = +3 Query: 312 GYVGLKNQGATCYMNSLLQTLYHIPYFRKAVYHMPTTEND 431 G GL+N G TCYMNS+LQ L H+ FR+ ++ ++ + Sbjct: 251 GVTGLRNLGNTCYMNSILQVLSHLQKFRECFLNLDPSKTE 290
>UBP12_YEAST (P39538) Ubiquitin carboxyl-terminal hydrolase 12 (EC 3.1.2.15)| (Ubiquitin thioesterase 12) (Ubiquitin-specific-processing protease 12) (Deubiquitinating enzyme 12) Length = 1254 Score = 41.2 bits (95), Expect = 0.001 Identities = 20/40 (50%), Positives = 26/40 (65%), Gaps = 1/40 (2%) Frame = +3 Query: 279 DYWSYDS-KKETGYVGLKNQGATCYMNSLLQTLYHIPYFR 395 +Y++Y+ + +G GL N G TCYMNS LQ L HIP R Sbjct: 350 NYFAYNKLEPASGTTGLVNLGNTCYMNSALQCLVHIPQLR 389
>UBPY_CAEEL (Q09931) Probable ubiquitin carboxyl-terminal hydrolase K02C4.3 (EC| 3.1.2.15) (Ubiquitin thioesterase) (Ubiquitin-specific processing protease) (Deubiquitinating enzyme) Length = 1302 Score = 41.2 bits (95), Expect = 0.001 Identities = 19/46 (41%), Positives = 28/46 (60%), Gaps = 1/46 (2%) Frame = +3 Query: 321 GLKNQGATCYMNSLLQTLYHIPYFRKAVYH-MPTTENDMPSGSIPL 455 GL N G TC++N L Q LY IP FR +YH P + ++ P ++ + Sbjct: 200 GLYNSGNTCWLNCLSQVLYSIPKFRSILYHCAPLSWHEQPITNVKI 245
>UBP38_HUMAN (Q8NB14) Ubiquitin carboxyl-terminal hydrolase 38 (EC 3.1.2.15)| (Ubiquitin thioesterase 38) (Ubiquitin-specific-processing protease 38) (Deubiquitinating enzyme 38) (HP43.8KD) Length = 1042 Score = 40.8 bits (94), Expect = 0.002 Identities = 19/35 (54%), Positives = 23/35 (65%) Frame = +3 Query: 300 KKETGYVGLKNQGATCYMNSLLQTLYHIPYFRKAV 404 K ETG GL N G TCYMNS++Q L+ FR+ V Sbjct: 439 KSETGKTGLINLGNTCYMNSVIQALFMATDFRRQV 473
>UBP13_HUMAN (Q92995) Ubiquitin carboxyl-terminal hydrolase 13 (EC 3.1.2.15)| (Ubiquitin thioesterase 13) (Ubiquitin-specific-processing protease 13) (Deubiquitinating enzyme 13) (Isopeptidase T-3) (ISOT-3) Length = 863 Score = 40.8 bits (94), Expect = 0.002 Identities = 15/30 (50%), Positives = 24/30 (80%) Frame = +3 Query: 312 GYVGLKNQGATCYMNSLLQTLYHIPYFRKA 401 GY GLKN G +CY++S++Q ++ IP F++A Sbjct: 334 GYTGLKNLGNSCYLSSVMQAIFSIPEFQRA 363
>UBP25_HUMAN (Q9UHP3) Ubiquitin carboxyl-terminal hydrolase 25 (EC 3.1.2.15)| (Ubiquitin thioesterase 25) (Ubiquitin-specific-processing protease 25) (Deubiquitinating enzyme 25) (USP on chromosome 21) Length = 1087 Score = 40.4 bits (93), Expect = 0.002 Identities = 20/52 (38%), Positives = 34/52 (65%), Gaps = 3/52 (5%) Frame = +3 Query: 291 YDSKKET-GYVGLKNQGATCYMNSLLQTLYHIPYFRKAV--YHMPTTENDMP 437 YD K++ VGLKN G TC+ ++++Q+L+++ FR+ V Y P+ D+P Sbjct: 159 YDRKRQDKAPVGLKNVGNTCWFSAVIQSLFNLLEFRRLVLNYKPPSNAQDLP 210
>UBP8_YEAST (P50102) Ubiquitin carboxyl-terminal hydrolase 8 (EC 3.1.2.15)| (Ubiquitin thioesterase 8) (Ubiquitin-specific processing protease 8) (Deubiquitinating enzyme 8) Length = 471 Score = 40.0 bits (92), Expect = 0.003 Identities = 22/56 (39%), Positives = 31/56 (55%) Frame = +3 Query: 225 LVNDTCVIEAEVAVCKVVDYWSYDSKKETGYVGLKNQGATCYMNSLLQTLYHIPYF 392 L+ND + + VC S + + G GL N G+TC+M+S+LQ L H PYF Sbjct: 108 LINDAILAKYWDDVCTKTMVPSME--RRDGLSGLINMGSTCFMSSILQCLIHNPYF 161
>UBP44_HUMAN (Q9H0E7) Ubiquitin carboxyl-terminal hydrolase 44 (EC 3.1.2.15)| (Ubiquitin thioesterase 44) (Ubiquitin-specific-processing protease 44) (Deubiquitinating enzyme 44) Length = 712 Score = 39.7 bits (91), Expect = 0.004 Identities = 17/29 (58%), Positives = 21/29 (72%) Frame = +3 Query: 312 GYVGLKNQGATCYMNSLLQTLYHIPYFRK 398 G GL+N G TCYMNS+LQ L H+ FR+ Sbjct: 271 GVTGLRNLGNTCYMNSVLQVLSHLLIFRQ 299
>UBP9_YEAST (P39967) Ubiquitin carboxyl-terminal hydrolase 9 (EC 3.1.2.15)| (Ubiquitin thioesterase 9) (Ubiquitin-specific-processing protease 9) (Deubiquitinating enzyme 9) Length = 754 Score = 39.7 bits (91), Expect = 0.004 Identities = 24/58 (41%), Positives = 30/58 (51%), Gaps = 2/58 (3%) Frame = +3 Query: 249 EAEVAVCKVVDYWSYD--SKKETGYVGLKNQGATCYMNSLLQTLYHIPYFRKAVYHMP 416 E+ + + D Y S K GY +N G TCY NS+LQ LY+IP FR V P Sbjct: 112 ESSILFTTITDLMPYGDGSNKVFGY---ENFGNTCYCNSVLQCLYNIPEFRCNVLRYP 166
>UBP13_YEAST (P38187) Ubiquitin carboxyl-terminal hydrolase 13 (EC 3.1.2.15)| (Ubiquitin thioesterase 13) (Ubiquitin-specific-processing protease 13) (Deubiquitinating enzyme 13) Length = 688 Score = 39.3 bits (90), Expect = 0.005 Identities = 26/67 (38%), Positives = 35/67 (52%), Gaps = 4/67 (5%) Frame = +3 Query: 249 EAEVAVCKVVDYWSYD--SKKETGYVGLKNQGATCYMNSLLQTLYHIPYFRKAVYHMP-- 416 EA + KV D Y S K GY +N G TCY NS+LQ LY++ R+ + P Sbjct: 118 EAPILAMKVSDSMPYGDGSNKVFGY---ENFGNTCYCNSVLQCLYNLSSLRENILQFPKK 174 Query: 417 TTENDMP 437 + E+D P Sbjct: 175 SRESDHP 181
>UBP5_MOUSE (P56399) Ubiquitin carboxyl-terminal hydrolase 5 (EC 3.1.2.15)| (Ubiquitin thioesterase 5) (Ubiquitin-specific-processing protease 5) (Deubiquitinating enzyme 5) (Isopeptidase T) Length = 858 Score = 39.3 bits (90), Expect = 0.005 Identities = 14/29 (48%), Positives = 23/29 (79%) Frame = +3 Query: 312 GYVGLKNQGATCYMNSLLQTLYHIPYFRK 398 GY G++N G +CY+NS++Q L+ IP F++ Sbjct: 324 GYTGIRNLGNSCYLNSVVQVLFSIPDFQR 352
>UBP5_HUMAN (P45974) Ubiquitin carboxyl-terminal hydrolase 5 (EC 3.1.2.15)| (Ubiquitin thioesterase 5) (Ubiquitin-specific-processing protease 5) (Deubiquitinating enzyme 5) (Isopeptidase T) Length = 858 Score = 39.3 bits (90), Expect = 0.005 Identities = 14/29 (48%), Positives = 23/29 (79%) Frame = +3 Query: 312 GYVGLKNQGATCYMNSLLQTLYHIPYFRK 398 GY G++N G +CY+NS++Q L+ IP F++ Sbjct: 324 GYTGIRNLGNSCYLNSVVQVLFSIPDFQR 352
>UBP28_MOUSE (Q5I043) Ubiquitin carboxyl-terminal hydrolase 28 (EC 3.1.2.15)| (Ubiquitin thioesterase 28) (Ubiquitin-specific-processing protease 28) (Deubiquitinating enzyme 28) Length = 1051 Score = 38.5 bits (88), Expect = 0.008 Identities = 16/35 (45%), Positives = 27/35 (77%), Gaps = 2/35 (5%) Frame = +3 Query: 318 VGLKNQGATCYMNSLLQTLYHIPYFRKAV--YHMP 416 VGLKN G TC+ ++++Q+L+ +P FR+ V Y++P Sbjct: 162 VGLKNVGNTCWFSAVIQSLFQLPEFRRLVLSYNLP 196
>UBP28_HUMAN (Q96RU2) Ubiquitin carboxyl-terminal hydrolase 28 (EC 3.1.2.15)| (Ubiquitin thioesterase 28) (Ubiquitin-specific-processing protease 28) (Deubiquitinating enzyme 28) Length = 1077 Score = 37.7 bits (86), Expect = 0.014 Identities = 16/35 (45%), Positives = 26/35 (74%), Gaps = 2/35 (5%) Frame = +3 Query: 318 VGLKNQGATCYMNSLLQTLYHIPYFRKAV--YHMP 416 VGLKN G TC+ ++++Q+L+ +P FR+ V Y +P Sbjct: 162 VGLKNVGNTCWFSAVIQSLFQLPEFRRLVLSYSLP 196
>UBP26_HUMAN (Q9BXU7) Ubiquitin carboxyl-terminal hydrolase 26 (EC 3.1.2.15)| (Ubiquitin thioesterase 26) (Ubiquitin-specific-processing protease 26) (Deubiquitinating enzyme 26) Length = 913 Score = 37.0 bits (84), Expect = 0.025 Identities = 20/45 (44%), Positives = 25/45 (55%) Frame = +3 Query: 321 GLKNQGATCYMNSLLQTLYHIPYFRKAVYHMPTTENDMPSGSIPL 455 GL N G TCYMN++LQ+L IP F + + P G IPL Sbjct: 296 GLPNLGNTCYMNAVLQSLLSIPSFADDLLN-----QSFPWGKIPL 335
>UBP28_CHICK (Q5ZID5) Ubiquitin carboxyl-terminal hydrolase 28 (EC 3.1.2.15)| (Ubiquitin thioesterase 28) (Ubiquitin-specific-processing protease 28) (Deubiquitinating enzyme 28) Length = 1047 Score = 36.6 bits (83), Expect = 0.032 Identities = 19/51 (37%), Positives = 31/51 (60%), Gaps = 6/51 (11%) Frame = +3 Query: 270 KVVDYWSYDSK----KETGY--VGLKNQGATCYMNSLLQTLYHIPYFRKAV 404 K + W +SK K G VG+KN G TC+ ++++Q+L+ +P FR+ V Sbjct: 134 KRCEVWGENSKQSDWKRVGDWPVGMKNIGNTCWFSAVIQSLFQLPQFRRLV 184
>UBP9_SCHPO (Q9P7V9) Probable ubiquitin carboxyl-terminal hydrolase 9 (EC| 3.1.2.15) (Ubiquitin thioesterase 9) (Ubiquitin-specific processing protease 9) (Deubiquitinating enzyme 9) Length = 585 Score = 36.6 bits (83), Expect = 0.032 Identities = 15/34 (44%), Positives = 23/34 (67%) Frame = +3 Query: 315 YVGLKNQGATCYMNSLLQTLYHIPYFRKAVYHMP 416 + GL N G TCY++S+L +LYH+ FR ++ P Sbjct: 40 FYGLTNYGNTCYVSSVLVSLYHLKPFRDSLNSYP 73
>UBPL_MIMIV (Q5UQR3) Probable ubiquitin carboxyl-terminal hydrolase (EC| 3.1.2.15) (Ubiquitin thioesterase) (Ubiquitin specific-processing protease) (Deubiquitinating enzyme) Length = 468 Score = 36.2 bits (82), Expect = 0.042 Identities = 21/63 (33%), Positives = 31/63 (49%) Frame = +3 Query: 192 LSELYNPSRGYLVNDTCVIEAEVAVCKVVDYWSYDSKKETGYVGLKNQGATCYMNSLLQT 371 + + N S+ + ND+ +I + + + SK G G+ N G TCYMNS LQ Sbjct: 1 MQNMMNTSQSFQ-NDSVLIGDKNTLQSINKSVDNGSKNTHGITGIMNLGNTCYMNSALQA 59 Query: 372 LYH 380 L H Sbjct: 60 LSH 62
>UBP29_MOUSE (Q9ES63) Ubiquitin carboxyl-terminal hydrolase 29 (EC 3.1.2.15)| (Ubiquitin thioesterase 29) (Ubiquitin-specific-processing protease 29) (Deubiquitinating enzyme 29) Length = 869 Score = 36.2 bits (82), Expect = 0.042 Identities = 15/26 (57%), Positives = 19/26 (73%) Frame = +3 Query: 321 GLKNQGATCYMNSLLQTLYHIPYFRK 398 G N G TCYMNS+LQ+++ IP F K Sbjct: 290 GFPNLGNTCYMNSILQSVFGIPTFAK 315
>UBP6_YEAST (P43593) Ubiquitin carboxyl-terminal hydrolase 6 (EC 3.1.2.15)| (Ubiquitin thioesterase 6) (Ubiquitin-specific-processing protease 6) (Deubiquitinating enzyme 6) Length = 499 Score = 36.2 bits (82), Expect = 0.042 Identities = 16/43 (37%), Positives = 24/43 (55%) Frame = +3 Query: 318 VGLKNQGATCYMNSLLQTLYHIPYFRKAVYHMPTTENDMPSGS 446 VG KN G TCY+N+ LQ LY + R + + ++ SG+ Sbjct: 109 VGFKNMGNTCYLNATLQALYRVNDLRDMILNYNPSQGVSNSGA 151
>UBP33_HUMAN (Q8TEY7) Ubiquitin carboxyl-terminal hydrolase 33 (EC 3.1.2.15)| (Ubiquitin thioesterase 33) (Ubiquitin-specific-processing protease 33) (Deubiquitinating enzyme 33) (VHL-interacting deubiquitinating enzyme 1) Length = 942 Score = 35.8 bits (81), Expect = 0.055 Identities = 16/31 (51%), Positives = 19/31 (61%) Frame = +3 Query: 294 DSKKETGYVGLKNQGATCYMNSLLQTLYHIP 386 D + G GLKN G TCYMN+ LQ L + P Sbjct: 177 DELRARGLTGLKNIGNTCYMNAALQALSNCP 207
>UBP11_HUMAN (P51784) Ubiquitin carboxyl-terminal hydrolase 11 (EC 3.1.2.15)| (Ubiquitin thioesterase 11) (Ubiquitin-specific-processing protease 11) (Deubiquitinating enzyme 11) Length = 920 Score = 35.8 bits (81), Expect = 0.055 Identities = 16/31 (51%), Positives = 20/31 (64%) Frame = +3 Query: 294 DSKKETGYVGLKNQGATCYMNSLLQTLYHIP 386 D K + G GL N G TC+MNS LQ L ++P Sbjct: 258 DFKGQPGICGLTNLGNTCFMNSALQCLSNVP 288
>UBP10_YEAST (P53874) Ubiquitin carboxyl-terminal hydrolase 10 (EC 3.1.2.15)| (Ubiquitin thioesterase 10) (Ubiquitin-specific-processing protease 10) (Deubiquitinating enzyme 10) (Disrupter of telomere silencing protein 4) Length = 792 Score = 35.4 bits (80), Expect = 0.072 Identities = 30/123 (24%), Positives = 50/123 (40%) Frame = +3 Query: 18 SMYLDVADSAVLPYGWTRYAQFSLSVVNQIHNKFTIRKETQHQFSARESDWGFTSFMPLS 197 S+Y D+ +++ + RY + + N N +E + + +S S P Sbjct: 269 SLYQDLMENSTVEVN--RYEPVNNTKENGNRNPKGEEEEEEEEDLKHKS----RSITPPV 322 Query: 198 ELYNPSRGYLVNDTCVIEAEVAVCKVVDYWSYDSKKETGYVGLKNQGATCYMNSLLQTLY 377 + N S Y N+ + ++V W D GL N G TCY N+ +Q + Sbjct: 323 TISNLSNFYQFNENINDRGSLNSTRIVKNWG-DKFTNLKPRGLLNHGVTCYTNAAVQAML 381 Query: 378 HIP 386 HIP Sbjct: 382 HIP 384
>UBP12_HUMAN (O75317) Ubiquitin carboxyl-terminal hydrolase 12 (EC 3.1.2.15)| (Ubiquitin thioesterase 12) (Ubiquitin-specific-processing protease 12) (Deubiquitinating enzyme 12) (Ubiquitin hydrolyzing enzyme 1) Length = 355 Score = 35.4 bits (80), Expect = 0.072 Identities = 17/30 (56%), Positives = 19/30 (63%) Frame = +3 Query: 315 YVGLKNQGATCYMNSLLQTLYHIPYFRKAV 404 Y GL N G TCY NS+LQ LY FR+ V Sbjct: 23 YFGLVNFGNTCYCNSVLQALYFCRPFREKV 52
>UBP29_HUMAN (Q9HBJ7) Ubiquitin carboxyl-terminal hydrolase 29 (EC 3.1.2.15)| (Ubiquitin thioesterase 29) (Ubiquitin-specific-processing protease 29) (Deubiquitinating enzyme 29) Length = 922 Score = 35.4 bits (80), Expect = 0.072 Identities = 16/33 (48%), Positives = 21/33 (63%) Frame = +3 Query: 294 DSKKETGYVGLKNQGATCYMNSLLQTLYHIPYF 392 DS + G N G TCYMN++LQ+L+ IP F Sbjct: 277 DSHSQQLQQGFPNLGNTCYMNAVLQSLFAIPSF 309
>UBP5_ARATH (O22207) Ubiquitin carboxyl-terminal hydrolase 5 (EC 3.1.2.15)| (Ubiquitin thioesterase 5) (Ubiquitin-specific-processing protease 5) (Deubiquitinating enzyme 5) (AtUBP5) Length = 924 Score = 35.0 bits (79), Expect = 0.093 Identities = 15/27 (55%), Positives = 17/27 (62%) Frame = +3 Query: 312 GYVGLKNQGATCYMNSLLQTLYHIPYF 392 G GL N G TC+MNS +Q L H P F Sbjct: 315 GLTGLLNLGNTCFMNSAIQCLVHTPEF 341
>UBP2_HUMAN (O75604) Ubiquitin carboxyl-terminal hydrolase 2 (EC 3.1.2.15)| (Ubiquitin thioesterase 2) (Ubiquitin-specific-processing protease 2) (Deubiquitinating enzyme 2) (41 kDa ubiquitin-specific protease) Length = 605 Score = 35.0 bits (79), Expect = 0.093 Identities = 15/27 (55%), Positives = 19/27 (70%) Frame = +3 Query: 294 DSKKETGYVGLKNQGATCYMNSLLQTL 374 +SK G GL+N G TC+MNS+LQ L Sbjct: 259 NSKSAQGLAGLRNLGNTCFMNSILQCL 285
>UBP2_MOUSE (O88623) Ubiquitin carboxyl-terminal hydrolase 2 (EC 3.1.2.15)| (Ubiquitin thioesterase 2) (Ubiquitin-specific-processing protease 2) (Deubiquitinating enzyme 2) (41 kDa ubiquitin-specific protease) Length = 353 Score = 35.0 bits (79), Expect = 0.093 Identities = 15/27 (55%), Positives = 19/27 (70%) Frame = +3 Query: 294 DSKKETGYVGLKNQGATCYMNSLLQTL 374 +SK G GL+N G TC+MNS+LQ L Sbjct: 7 NSKSAQGLAGLRNLGNTCFMNSILQCL 33
>UBP46_MOUSE (P62069) Ubiquitin carboxyl-terminal hydrolase 46 (EC 3.1.2.15)| (Ubiquitin thioesterase 46) (Ubiquitin-specific-processing protease 46) (Deubiquitinating enzyme 46) Length = 366 Score = 35.0 bits (79), Expect = 0.093 Identities = 17/30 (56%), Positives = 19/30 (63%) Frame = +3 Query: 315 YVGLKNQGATCYMNSLLQTLYHIPYFRKAV 404 Y GL N G TCY NS+LQ LY FR+ V Sbjct: 34 YFGLVNFGNTCYCNSVLQALYFCRPFRENV 63
>UBP46_HUMAN (P62068) Ubiquitin carboxyl-terminal hydrolase 46 (EC 3.1.2.15)| (Ubiquitin thioesterase 46) (Ubiquitin-specific-processing protease 46) (Deubiquitinating enzyme 46) Length = 366 Score = 35.0 bits (79), Expect = 0.093 Identities = 17/30 (56%), Positives = 19/30 (63%) Frame = +3 Query: 315 YVGLKNQGATCYMNSLLQTLYHIPYFRKAV 404 Y GL N G TCY NS+LQ LY FR+ V Sbjct: 34 YFGLVNFGNTCYCNSVLQALYFCRPFRENV 63
>UBP8_HUMAN (P40818) Ubiquitin carboxyl-terminal hydrolase 8 (EC 3.1.2.15)| (Ubiquitin thioesterase 8) (Ubiquitin-specific processing protease 8) (Deubiquitinating enzyme 8) (hUBPy) Length = 1118 Score = 35.0 bits (79), Expect = 0.093 Identities = 17/33 (51%), Positives = 21/33 (63%), Gaps = 4/33 (12%) Frame = +3 Query: 321 GLKNQGATCYMNSLLQTLYHIP----YFRKAVY 407 GL+N G TCYMNS+LQ L + P YF + Y Sbjct: 778 GLRNLGNTCYMNSILQCLCNAPHLADYFNRNCY 810
>UBP20_HUMAN (Q9Y2K6) Ubiquitin carboxyl-terminal hydrolase 20 (EC 3.1.2.15)| (Ubiquitin thioesterase 20) (Ubiquitin-specific-processing protease 20) (Deubiquitinating enzyme 20) Length = 913 Score = 35.0 bits (79), Expect = 0.093 Identities = 15/31 (48%), Positives = 19/31 (61%) Frame = +3 Query: 294 DSKKETGYVGLKNQGATCYMNSLLQTLYHIP 386 D K G G+KN G +CYMN+ LQ L + P Sbjct: 137 DDLKPRGLTGMKNLGNSCYMNAALQALSNCP 167
>UBP8_MOUSE (Q80U87) Ubiquitin carboxyl-terminal hydrolase 8 (EC 3.1.2.15)| (Ubiquitin thioesterase 8) (Ubiquitin-specific-processing protease 8) (Deubiquitinating enzyme 8) (mUBPy) Length = 1080 Score = 35.0 bits (79), Expect = 0.093 Identities = 17/33 (51%), Positives = 21/33 (63%), Gaps = 4/33 (12%) Frame = +3 Query: 321 GLKNQGATCYMNSLLQTLYHIP----YFRKAVY 407 GL+N G TCYMNS+LQ L + P YF + Y Sbjct: 740 GLRNLGNTCYMNSILQCLCNAPHLADYFNRNCY 772
>UBP3_ARATH (O24454) Ubiquitin carboxyl-terminal hydrolase 3 (EC 3.1.2.15)| (Ubiquitin thioesterase 3) (Ubiquitin-specific-processing protease 3) (Deubiquitinating enzyme 3) (AtUBP3) Length = 371 Score = 34.7 bits (78), Expect = 0.12 Identities = 16/40 (40%), Positives = 22/40 (55%) Frame = +3 Query: 315 YVGLKNQGATCYMNSLLQTLYHIPYFRKAVYHMPTTENDM 434 Y G +N G TCY NS+LQ LY FR+ + T+ + Sbjct: 22 YFGFENFGNTCYCNSVLQALYFCVPFREQLLEYYTSNKSV 61
>UBP12_SCHPO (O60079) Probable ubiquitin carboxyl-terminal hydrolase 12 (EC| 3.1.2.15) (Ubiquitin thioesterase 12) (Ubiquitin-specific processing protease 12) (Deubiquitinating enzyme 12) Length = 979 Score = 34.7 bits (78), Expect = 0.12 Identities = 16/27 (59%), Positives = 17/27 (62%) Frame = +3 Query: 300 KKETGYVGLKNQGATCYMNSLLQTLYH 380 K+ G GL N G TCYMNS LQ L H Sbjct: 305 KRVPGTCGLSNLGNTCYMNSALQCLTH 331
>UBP11_MOUSE (Q99K46) Ubiquitin carboxyl-terminal hydrolase 11 (EC 3.1.2.15)| (Ubiquitin thioesterase 11) (Ubiquitin-specific-processing protease 11) (Deubiquitinating enzyme 11) (Fragment) Length = 797 Score = 34.3 bits (77), Expect = 0.16 Identities = 15/31 (48%), Positives = 20/31 (64%) Frame = +3 Query: 294 DSKKETGYVGLKNQGATCYMNSLLQTLYHIP 386 D + + G GL N G TC+MNS LQ L ++P Sbjct: 125 DFQGQPGICGLTNLGNTCFMNSALQCLSNVP 155
>UBP1_SCHPO (Q9USM5) Probable ubiquitin carboxyl-terminal hydrolase 1 (EC| 3.1.2.15) (Ubiquitin thioesterase 1) (Ubiquitin-specific processing protease 1) (Deubiquitinating enzyme 1) Length = 849 Score = 34.3 bits (77), Expect = 0.16 Identities = 15/26 (57%), Positives = 17/26 (65%) Frame = +3 Query: 303 KETGYVGLKNQGATCYMNSLLQTLYH 380 KE G GL N G +CYMNS LQ + H Sbjct: 274 KEIGLCGLYNLGNSCYMNSALQCMIH 299
>UBP4_ARATH (Q8LAM0) Ubiquitin carboxyl-terminal hydrolase 4 (EC 3.1.2.15)| (Ubiquitin thioesterase 4) (Ubiquitin-specific-processing protease 4) (Deubiquitinating enzyme 4) (AtUBP4) Length = 365 Score = 34.3 bits (77), Expect = 0.16 Identities = 15/28 (53%), Positives = 18/28 (64%) Frame = +3 Query: 315 YVGLKNQGATCYMNSLLQTLYHIPYFRK 398 Y G +N G TCY NS+LQ LY FR+ Sbjct: 22 YFGFENFGNTCYCNSVLQALYFCAPFRE 49
>UBP8_SCHPO (Q09738) Probable ubiquitin carboxyl-terminal hydrolase 8 (EC| 3.1.2.15) (Ubiquitin thioesterase 8) (Ubiquitin-specific processing protease 8) (Deubiquitinating enzyme 8) Length = 449 Score = 33.9 bits (76), Expect = 0.21 Identities = 15/40 (37%), Positives = 23/40 (57%) Frame = +3 Query: 312 GYVGLKNQGATCYMNSLLQTLYHIPYFRKAVYHMPTTEND 431 G G++N GATC+M+ +LQ++ H P R + T D Sbjct: 143 GLRGIQNLGATCFMSVILQSILHNPLVRNLFFSGFHTSTD 182
>UBPX_CAEEL (P34547) Probable ubiquitin carboxyl-terminal hydrolase R10E11.3| (EC 3.1.2.15) (Ubiquitin thioesterase) (Ubiquitin-specific processing protease) (Deubiquitinating enzyme) Length = 410 Score = 33.9 bits (76), Expect = 0.21 Identities = 16/36 (44%), Positives = 21/36 (58%) Frame = +3 Query: 315 YVGLKNQGATCYMNSLLQTLYHIPYFRKAVYHMPTT 422 Y GL N G TCY NS++Q L+ FR+ V + T Sbjct: 26 YYGLVNFGNTCYCNSVIQALFFCRPFREKVLNYKQT 61
>UBP3_HUMAN (Q9Y6I4) Ubiquitin carboxyl-terminal hydrolase 3 (EC 3.1.2.15)| (Ubiquitin thioesterase 3) (Ubiquitin-specific-processing protease 3) (Deubiquitinating enzyme 3) Length = 521 Score = 33.5 bits (75), Expect = 0.27 Identities = 15/35 (42%), Positives = 22/35 (62%) Frame = +3 Query: 321 GLKNQGATCYMNSLLQTLYHIPYFRKAVYHMPTTE 425 GL+N G TC+MN++LQ+L +I F +P E Sbjct: 160 GLRNLGNTCFMNAILQSLSNIEQFCCYFKELPAVE 194
>UBP2_CHICK (O57429) Ubiquitin carboxyl-terminal hydrolase 2 (EC 3.1.2.15)| (Ubiquitin thioesterase 2) (Ubiquitin-specific-processing protease 2) (Deubiquitinating enzyme 2) (41 kDa ubiquitin-specific protease) Length = 357 Score = 33.5 bits (75), Expect = 0.27 Identities = 15/26 (57%), Positives = 18/26 (69%) Frame = +3 Query: 297 SKKETGYVGLKNQGATCYMNSLLQTL 374 SK G GL+N G TC+MNS+LQ L Sbjct: 12 SKVVQGLTGLRNLGNTCFMNSILQCL 37
>UBP3_MOUSE (Q91W36) Ubiquitin carboxyl-terminal hydrolase 3 (EC 3.1.2.15)| (Ubiquitin thioesterase 3) (Ubiquitin-specific-processing protease 3) (Deubiquitinating enzyme 3) Length = 520 Score = 33.5 bits (75), Expect = 0.27 Identities = 15/35 (42%), Positives = 22/35 (62%) Frame = +3 Query: 321 GLKNQGATCYMNSLLQTLYHIPYFRKAVYHMPTTE 425 GL+N G TC+MN++LQ+L +I F +P E Sbjct: 160 GLRNLGNTCFMNAILQSLSNIEQFCCYFKELPAVE 194
>UBP15_MOUSE (Q8R5H1) Ubiquitin carboxyl-terminal hydrolase 15 (EC 3.1.2.15)| (Ubiquitin thioesterase 15) (Ubiquitin-specific-processing protease 15) (Deubiquitinating enzyme 15) Length = 981 Score = 33.1 bits (74), Expect = 0.36 Identities = 18/59 (30%), Positives = 29/59 (49%), Gaps = 6/59 (10%) Frame = +3 Query: 228 VNDTCVIEAEVAVCKVVDYWSYD------SKKETGYVGLKNQGATCYMNSLLQTLYHIP 386 +N+ V + + Y +YD + ++ G GL N G TC+MNS +Q L + P Sbjct: 253 INNRNVKNSNYCLPSYTAYKNYDYSEPGRNNEQPGLCGLSNLGNTCFMNSAIQCLSNTP 311
>UBP2_YEAST (Q01476) Ubiquitin carboxyl-terminal hydrolase 2 (EC 3.1.2.15)| (Ubiquitin thioesterase 2) (Ubiquitin-specific-processing protease 2) (Deubiquitinating enzyme 2) Length = 1272 Score = 33.1 bits (74), Expect = 0.36 Identities = 17/37 (45%), Positives = 22/37 (59%), Gaps = 1/37 (2%) Frame = +3 Query: 321 GLKNQGATCYMNSLLQTLYHI-PYFRKAVYHMPTTEN 428 G+ N G TCY+NSLLQ + I P R + + T EN Sbjct: 737 GINNIGNTCYLNSLLQYYFSIAPLRRYVLEYQKTVEN 773
>UBP51_HUMAN (Q70EK9) Ubiquitin carboxyl-terminal hydrolase 51 (EC 3.1.2.15)| (Ubiquitin thioesterase 51) (Ubiquitin-specific-processing protease 51) (Deubiquitinating enzyme 51) Length = 711 Score = 33.1 bits (74), Expect = 0.36 Identities = 14/28 (50%), Positives = 18/28 (64%) Frame = +3 Query: 312 GYVGLKNQGATCYMNSLLQTLYHIPYFR 395 G GL N G TC+MN ++Q L HIP + Sbjct: 361 GLRGLINLGNTCFMNCIVQALTHIPLLK 388
>UBP6_SCHPO (Q92353) Ubiquitin carboxyl-terminal hydrolase 6 (EC 3.1.2.15)| (Ubiquitin thiolesterase 6) (Ubiquitin-specific processing protease 6) (Deubiquitinating enzyme 6) Length = 467 Score = 32.7 bits (73), Expect = 0.46 Identities = 18/38 (47%), Positives = 22/38 (57%), Gaps = 1/38 (2%) Frame = +3 Query: 294 DSKKETGYV-GLKNQGATCYMNSLLQTLYHIPYFRKAV 404 + ++ GY GL N G TCYMNS +Q L IP AV Sbjct: 91 EESEDDGYPSGLINLGNTCYMNSTVQMLRAIPELSDAV 128
>UBP15_HUMAN (Q9Y4E8) Ubiquitin carboxyl-terminal hydrolase 15 (EC 3.1.2.15)| (Ubiquitin thioesterase 15) (Ubiquitin-specific-processing protease 15) (Deubiquitinating enzyme 15) (Unph-2) (Unph4) Length = 981 Score = 32.3 bits (72), Expect = 0.61 Identities = 16/41 (39%), Positives = 23/41 (56%), Gaps = 6/41 (14%) Frame = +3 Query: 282 YWSYD------SKKETGYVGLKNQGATCYMNSLLQTLYHIP 386 Y +YD + ++ G GL N G TC+MNS +Q L + P Sbjct: 271 YKNYDYSEPGRNNEQPGLCGLSNLGNTCFMNSAIQCLSNTP 311
>UBP21_MOUSE (Q9QZL6) Ubiquitin carboxyl-terminal hydrolase 21 (EC 3.1.2.15)| (Ubiquitin thioesterase 21) (Ubiquitin-specific processing protease 21) (Deubiquitinating enzyme 21) Length = 566 Score = 32.3 bits (72), Expect = 0.61 Identities = 12/22 (54%), Positives = 19/22 (86%) Frame = +3 Query: 309 TGYVGLKNQGATCYMNSLLQTL 374 +G+VGL+N G TC++N++LQ L Sbjct: 209 SGHVGLRNLGNTCFLNAVLQCL 230
>UBP30_HUMAN (Q70CQ3) Ubiquitin carboxyl-terminal hydrolase 30 (EC 3.1.2.15)| (Ubiquitin thioesterase 30) (Ubiquitin-specific-processing protease 30) (Deubiquitinating enzyme 30) Length = 517 Score = 32.3 bits (72), Expect = 0.61 Identities = 18/32 (56%), Positives = 20/32 (62%), Gaps = 1/32 (3%) Frame = +3 Query: 300 KKETGYV-GLKNQGATCYMNSLLQTLYHIPYF 392 K+ G V GL N G TC+MNSLLQ L P F Sbjct: 61 KRRKGLVPGLVNLGNTCFMNSLLQGLSACPAF 92
>DYHC_DROME (P37276) Dynein heavy chain, cytosolic (DYHC)| Length = 4639 Score = 32.3 bits (72), Expect = 0.61 Identities = 34/119 (28%), Positives = 47/119 (39%), Gaps = 13/119 (10%) Frame = +3 Query: 48 VLPYGWTRYAQFSLSVVNQIHNKFTIRKETQHQFSARESDWGFTSFMP----LSELYNPS 215 ++P GW RY + V Q F+ R + + S S G L L NP Sbjct: 4449 IIPKGWKRYTVPAGCTVIQWITDFSNRVQQLQKVSQLVSQAGAKELQGFPVWLGGLLNPE 4508 Query: 216 RGYLVNDTCVIEA------EVAV-CKVVDYWSYDSKKET--GYVGLKNQGATCYMNSLL 365 CV +A E+A+ + D + +K+ G GLK QGA C N LL Sbjct: 4509 AYITATRQCVAQANSWSLEELALDVTITDAGLKNDQKDCCFGVTGLKLQGAQCKNNELL 4567
>UBP22_MOUSE (Q5DU02) Ubiquitin carboxyl-terminal hydrolase 22 (EC 3.1.2.15)| (Ubiquitin thioesterase 22) (Ubiquitin-specific-processing protease 22) (Deubiquitinating enzyme 22) Length = 525 Score = 32.3 bits (72), Expect = 0.61 Identities = 14/28 (50%), Positives = 17/28 (60%) Frame = +3 Query: 312 GYVGLKNQGATCYMNSLLQTLYHIPYFR 395 G GL N G TC+MN ++Q L H P R Sbjct: 174 GLRGLINLGNTCFMNCIVQALTHTPLLR 201
>UBP22_HUMAN (Q9UPT9) Ubiquitin carboxyl-terminal hydrolase 22 (EC 3.1.2.15)| (Ubiquitin thioesterase 22) (Ubiquitin-specific-processing protease 22) (Deubiquitinating enzyme 22) Length = 525 Score = 32.3 bits (72), Expect = 0.61 Identities = 14/28 (50%), Positives = 17/28 (60%) Frame = +3 Query: 312 GYVGLKNQGATCYMNSLLQTLYHIPYFR 395 G GL N G TC+MN ++Q L H P R Sbjct: 174 GLRGLINLGNTCFMNCIVQALTHTPLLR 201
>UBP7_YEAST (P40453) Ubiquitin carboxyl-terminal hydrolase 7 (EC 3.1.2.15)| (Ubiquitin thioesterase 7) (Ubiquitin-specific-processing protease 7) (Deubiquitinating enzyme 7) Length = 1071 Score = 32.3 bits (72), Expect = 0.61 Identities = 13/25 (52%), Positives = 18/25 (72%) Frame = +3 Query: 321 GLKNQGATCYMNSLLQTLYHIPYFR 395 GL+N G TCY+NS++Q L+ FR Sbjct: 610 GLRNLGNTCYINSMIQCLFAAKTFR 634
>UBP21_HUMAN (Q9UK80) Ubiquitin carboxyl-terminal hydrolase 21 (EC 3.1.2.15)| (Ubiquitin thioesterase 21) (Ubiquitin-specific-processing protease 21) (Deubiquitinating enzyme 21) (NEDD8-specific protease) Length = 565 Score = 32.3 bits (72), Expect = 0.61 Identities = 12/22 (54%), Positives = 19/22 (86%) Frame = +3 Query: 309 TGYVGLKNQGATCYMNSLLQTL 374 +G+VGL+N G TC++N++LQ L Sbjct: 209 SGHVGLRNLGNTCFLNAVLQCL 230
>UBPW_MOUSE (Q61068) Ubiquitin carboxyl-terminal hydrolase DUB-1 (EC 3.1.2.15)| (Ubiquitin thioesterase DUB-1) (Ubiquitin-specific processing protease DUB-1) (Deubiquitinating enzyme 1) Length = 526 Score = 32.0 bits (71), Expect = 0.79 Identities = 15/33 (45%), Positives = 22/33 (66%) Frame = +3 Query: 288 SYDSKKETGYVGLKNQGATCYMNSLLQTLYHIP 386 S++S + G GL+N G +CY+N+ LQ L H P Sbjct: 42 SWESPQGPG-CGLQNTGNSCYLNAALQCLTHTP 73
>UBP26_MOUSE (Q99MX1) Ubiquitin carboxyl-terminal hydrolase 26 (EC 3.1.2.15)| (Ubiquitin thioesterase 26) (Ubiquitin-specific-processing protease 26) (Deubiquitinating enzyme 26) Length = 835 Score = 32.0 bits (71), Expect = 0.79 Identities = 14/24 (58%), Positives = 17/24 (70%) Frame = +3 Query: 321 GLKNQGATCYMNSLLQTLYHIPYF 392 GL N G TCY+N +LQ+L IP F Sbjct: 287 GLPNVGNTCYINVVLQSLCSIPLF 310
>UBP11_YEAST (P36026) Ubiquitin carboxyl-terminal hydrolase 11 (EC 3.1.2.15)| (Ubiquitin thioesterase 11) (Ubiquitin-specific-processing protease 11) (Deubiquitinating enzyme 11) Length = 717 Score = 32.0 bits (71), Expect = 0.79 Identities = 15/36 (41%), Positives = 20/36 (55%) Frame = +3 Query: 288 SYDSKKETGYVGLKNQGATCYMNSLLQTLYHIPYFR 395 S D E GL+N TCY+NS++Q L+ FR Sbjct: 288 SNDLLSELSITGLQNPCNTCYINSIIQCLFGTTLFR 323
>UBP37_HUMAN (Q86T82) Ubiquitin carboxyl-terminal hydrolase 37 (EC 3.1.2.15)| (Ubiquitin thioesterase 37) (Ubiquitin-specific-processing protease 37) (Deubiquitinating enzyme 37) Length = 979 Score = 31.6 bits (70), Expect = 1.0 Identities = 12/24 (50%), Positives = 17/24 (70%) Frame = +3 Query: 321 GLKNQGATCYMNSLLQTLYHIPYF 392 G N G TCYMN++LQ+L+ + F Sbjct: 342 GFSNLGNTCYMNAILQSLFSLQSF 365
>UBP2_SCHPO (Q9P3U0) Probable ubiquitin carboxyl-terminal hydrolase 2 (EC| 3.1.2.15) (Ubiquitin thioesterase 2) (Ubiquitin-specific processing protease 2) (Deubiquitinating enzyme 2) Length = 1141 Score = 31.6 bits (70), Expect = 1.0 Identities = 13/29 (44%), Positives = 19/29 (65%) Frame = +3 Query: 318 VGLKNQGATCYMNSLLQTLYHIPYFRKAV 404 +GL+N G CY+NSL+Q + I R A+ Sbjct: 614 IGLENTGNLCYLNSLIQYYFIIKPLRNAI 642
>UBP19_HUMAN (O94966) Ubiquitin carboxyl-terminal hydrolase 19 (EC 3.1.2.15)| (Ubiquitin thioesterase 19) (Ubiquitin-specific-processing protease 19) (Deubiquitinating enzyme 19) (Zinc finger MYND domain-containing protein 9) (Fragment) Length = 1371 Score = 31.6 bits (70), Expect = 1.0 Identities = 12/21 (57%), Positives = 17/21 (80%) Frame = +3 Query: 312 GYVGLKNQGATCYMNSLLQTL 374 G+ GL N G TC+MNS++Q+L Sbjct: 548 GFTGLVNLGNTCFMNSVIQSL 568
>YAA4_SCHPO (Q09798) Hypothetical protein C22G7.04 in chromosome I| Length = 1115 Score = 31.2 bits (69), Expect = 1.3 Identities = 14/42 (33%), Positives = 23/42 (54%) Frame = +3 Query: 276 VDYWSYDSKKETGYVGLKNQGATCYMNSLLQTLYHIPYFRKA 401 ++ + + +T Y GL+ Y NS+LQ L ++P F KA Sbjct: 486 IEDFDFGFYNKTKYAGLETDITNSYCNSVLQLLSYVPSFSKA 527
>UBP14_SCHPO (Q11119) Ubiquitin carboxyl-terminal hydrolase 14 (EC 3.1.2.15)| (Ubiquitin thioesterase 14) (Ubiquitin-specific-processing protease 14) (Deubiquitinating enzyme 14) (UBA-domain-containing protein 2) Length = 775 Score = 31.2 bits (69), Expect = 1.3 Identities = 13/27 (48%), Positives = 18/27 (66%) Frame = +3 Query: 312 GYVGLKNQGATCYMNSLLQTLYHIPYF 392 G GLKN G +CY+ S +Q+L+ I F Sbjct: 298 GLTGLKNLGNSCYLASTMQSLFSIKEF 324
>MEP1B_HUMAN (Q16820) Meprin A beta-subunit precursor (EC 3.4.24.18)| (Endopeptidase-2) (N-benzoyl-L-tyrosyl-P-amino-benzoic acid hydrolase beta subunit) (PABA peptide hydrolase) (PPH beta) Length = 701 Score = 31.2 bits (69), Expect = 1.3 Identities = 21/84 (25%), Positives = 36/84 (42%), Gaps = 1/84 (1%) Frame = +3 Query: 30 DVADSAVLPYGWTRYAQFSLSVV-NQIHNKFTIRKETQHQFSARESDWGFTSFMPLSELY 206 D++DS +PY +T +S + N R + D+ + + L++LY Sbjct: 194 DISDSLNVPYDYTSVMHYSKTAFQNGTEPTIVTRISDFEDVIGQRMDFSDSDLLKLNQLY 253 Query: 207 NPSRGYLVNDTCVIEAEVAVCKVV 278 N S D+C E E VC ++ Sbjct: 254 NCSSSLSFMDSCSFELE-NVCGMI 276
>UBP1_YEAST (P25037) Ubiquitin carboxyl-terminal hydrolase 1 (EC 3.1.2.15)| (Ubiquitin thioesterase 1) (Ubiquitin-specific-processing protease 1) (Deubiquitinating enzyme 1) Length = 809 Score = 30.8 bits (68), Expect = 1.8 Identities = 14/25 (56%), Positives = 19/25 (76%), Gaps = 1/25 (4%) Frame = +3 Query: 303 KETGYV-GLKNQGATCYMNSLLQTL 374 K G++ GL N G TC+MNS+LQ+L Sbjct: 95 KRGGFIAGLVNDGNTCFMNSVLQSL 119
>UBP7_SCHPO (Q9P7S5) Probable ubiquitin carboxyl-terminal hydrolase 7 (EC| 3.1.2.15) (Ubiquitin thioesterase 7) (Ubiquitin-specific processing protease 7) (Deubiquitinating enzyme 7) Length = 875 Score = 30.8 bits (68), Expect = 1.8 Identities = 13/18 (72%), Positives = 14/18 (77%) Frame = +3 Query: 321 GLKNQGATCYMNSLLQTL 374 GLKN GATC+ NS LQ L Sbjct: 209 GLKNLGATCFFNSTLQVL 226
>UBP14_HUMAN (P54578) Ubiquitin carboxyl-terminal hydrolase 14 (EC 3.1.2.15)| (Ubiquitin thioesterase 14) (Ubiquitin-specific-processing protease 14) (Deubiquitinating enzyme 14) Length = 493 Score = 30.4 bits (67), Expect = 2.3 Identities = 12/28 (42%), Positives = 18/28 (64%) Frame = +3 Query: 321 GLKNQGATCYMNSLLQTLYHIPYFRKAV 404 GL N G TCYMN+ +Q + +P + A+ Sbjct: 105 GLTNLGNTCYMNATVQCIRSVPELKDAL 132
>SK2L2_MOUSE (Q9CZU3) Superkiller viralicidic activity 2-like 2 (EC 3.6.1.-)| (ATP-dependent helicase SKIV2L2) Length = 1040 Score = 30.4 bits (67), Expect = 2.3 Identities = 12/32 (37%), Positives = 16/32 (50%) Frame = +2 Query: 308 DWLCWPQKPRCHLLYEFSPSDSLSHSIFQKGG 403 +W+C K CH++Y L H IF GG Sbjct: 292 EWICHLHKQPCHVIYTDYRPTPLQHYIFPAGG 323
>UBP4_SCHPO (O60139) Probable ubiquitin carboxyl-terminal hydrolase 4 (EC| 3.1.2.15) (Ubiquitin thioesterase 4) (Ubiquitin-specific processing protease 4) (Deubiquitinating enzyme 4) Length = 438 Score = 30.4 bits (67), Expect = 2.3 Identities = 12/20 (60%), Positives = 15/20 (75%) Frame = +3 Query: 318 VGLKNQGATCYMNSLLQTLY 377 +GL N G TCYMN +LQ L+ Sbjct: 72 IGLTNLGNTCYMNCVLQCLF 91
>UBP14_RABIT (P40826) Ubiquitin carboxyl-terminal hydrolase 14 (EC 3.1.2.15)| (Ubiquitin thioesterase 14) (Ubiquitin-specific-processing protease 14) (Deubiquitinating enzyme 14) Length = 492 Score = 30.4 bits (67), Expect = 2.3 Identities = 12/28 (42%), Positives = 18/28 (64%) Frame = +3 Query: 321 GLKNQGATCYMNSLLQTLYHIPYFRKAV 404 GL N G TCYMN+ +Q + +P + A+ Sbjct: 105 GLTNLGNTCYMNATVQCIRSVPELKDAL 132
>UBP14_PANTR (P60051) Ubiquitin carboxyl-terminal hydrolase 14 (EC 3.1.2.15)| (Ubiquitin thioesterase 14) (Ubiquitin-specific-processing protease 14) (Deubiquitinating enzyme 14) Length = 492 Score = 30.4 bits (67), Expect = 2.3 Identities = 12/28 (42%), Positives = 18/28 (64%) Frame = +3 Query: 321 GLKNQGATCYMNSLLQTLYHIPYFRKAV 404 GL N G TCYMN+ +Q + +P + A+ Sbjct: 105 GLTNLGNTCYMNATVQCIRSVPELKDAL 132
>UBP14_MOUSE (Q9JMA1) Ubiquitin carboxyl-terminal hydrolase 14 (EC 3.1.2.15)| (Ubiquitin thioesterase 14) (Ubiquitin-specific-processing protease 14) (Deubiquitinating enzyme 14) Length = 492 Score = 30.4 bits (67), Expect = 2.3 Identities = 12/28 (42%), Positives = 18/28 (64%) Frame = +3 Query: 321 GLKNQGATCYMNSLLQTLYHIPYFRKAV 404 GL N G TCYMN+ +Q + +P + A+ Sbjct: 105 GLTNLGNTCYMNATVQCIRSVPELKDAL 132
>SK2L2_HUMAN (P42285) Superkiller viralicidic activity 2-like 2 (EC 3.6.1.-)| (ATP-dependent helicase SKIV2L2) Length = 1042 Score = 30.4 bits (67), Expect = 2.3 Identities = 12/32 (37%), Positives = 16/32 (50%) Frame = +2 Query: 308 DWLCWPQKPRCHLLYEFSPSDSLSHSIFQKGG 403 +W+C K CH++Y L H IF GG Sbjct: 294 EWICHLHKQPCHVIYTDYRPTPLQHYIFPAGG 325
>CP52A_CANTR (P10615) Cytochrome P450 52A1 (EC 1.14.14.-) (CYPLIIA1)| (Alkane-inducible P450-ALK1) Length = 543 Score = 30.0 bits (66), Expect = 3.0 Identities = 14/53 (26%), Positives = 26/53 (49%) Frame = +3 Query: 84 SLSVVNQIHNKFTIRKETQHQFSARESDWGFTSFMPLSELYNPSRGYLVNDTC 242 SL++++ +H K+ RK + D+ F PL +Y S+G ++ C Sbjct: 39 SLNLISMLHTKYLERKFKAKPLAVYVQDYTFCLITPLVLIYYKSKGTVMQFAC 91
>UBP2_KLULA (O42726) Ubiquitin carboxyl-terminal hydrolase 2 (EC 3.1.2.15)| (Ubiquitin thioesterase 2) (Ubiquitin-specific-processing protease 2) (Deubiquitinating enzyme 2) Length = 1220 Score = 30.0 bits (66), Expect = 3.0 Identities = 13/25 (52%), Positives = 16/25 (64%) Frame = +3 Query: 321 GLKNQGATCYMNSLLQTLYHIPYFR 395 G+ N G TCY+NSLLQ + I R Sbjct: 699 GINNVGNTCYLNSLLQFFFTIKPLR 723
>UBP4_HUMAN (Q13107) Ubiquitin carboxyl-terminal hydrolase 4 (EC 3.1.2.15)| (Ubiquitin thioesterase 4) (Ubiquitin-specific-processing protease 4) (Deubiquitinating enzyme 4) (Ubiquitous nuclear protein homolog) Length = 963 Score = 29.6 bits (65), Expect = 3.9 Identities = 17/38 (44%), Positives = 20/38 (52%), Gaps = 4/38 (10%) Frame = +3 Query: 306 ETGYVGLKNQGATCYMNSLLQTLYH----IPYFRKAVY 407 + G GL N G TC+MNS LQ L + YF K Y Sbjct: 298 QPGLCGLGNLGNTCFMNSALQCLSNTAPLTDYFLKDEY 335
>UBP4_MOUSE (P35123) Ubiquitin carboxyl-terminal hydrolase 4 (EC 3.1.2.15)| (Ubiquitin thioesterase 4) (Ubiquitin-specific-processing protease 4) (Deubiquitinating enzyme 4) (Ubiquitous nuclear protein) Length = 962 Score = 29.6 bits (65), Expect = 3.9 Identities = 17/38 (44%), Positives = 20/38 (52%), Gaps = 4/38 (10%) Frame = +3 Query: 306 ETGYVGLKNQGATCYMNSLLQTLYH----IPYFRKAVY 407 + G GL N G TC+MNS LQ L + YF K Y Sbjct: 298 QPGLCGLGNLGNTCFMNSALQCLSNTAPLTEYFLKDEY 335
>UBP2_ARATH (Q8W4N3) Ubiquitin carboxyl-terminal hydrolase 2 (EC 3.1.2.15)| (Ubiquitin thioesterase 2) (Ubiquitin-specific-processing protease 2) (Deubiquitinating enzyme 2) (AtUBP2) Length = 961 Score = 29.6 bits (65), Expect = 3.9 Identities = 15/36 (41%), Positives = 20/36 (55%), Gaps = 2/36 (5%) Frame = +3 Query: 294 DSKKETGYV--GLKNQGATCYMNSLLQTLYHIPYFR 395 D + GYV GL N G TC+ NS++Q L + R Sbjct: 221 DIEARDGYVVRGLVNLGNTCFFNSIMQNLLSLDRLR 256
>UBP32_HUMAN (Q8NFA0) Ubiquitin carboxyl-terminal hydrolase 32 (EC 3.1.2.15)| (Ubiquitin thioesterase 32) (Ubiquitin-specific-processing protease 32) (Deubiquitinating enzyme 32) (NY-REN-60 antigen) Length = 1604 Score = 28.9 bits (63), Expect = 6.7 Identities = 12/21 (57%), Positives = 14/21 (66%) Frame = +3 Query: 306 ETGYVGLKNQGATCYMNSLLQ 368 E G GL N G TC+MNS +Q Sbjct: 730 EKGATGLSNLGNTCFMNSSIQ 750
>UBA1_SCHPO (O94609) Ubiquitin-activating enzyme E1 1 (Poly(A)+ RNA transport| protein 3) Length = 1012 Score = 28.9 bits (63), Expect = 6.7 Identities = 13/52 (25%), Positives = 26/52 (50%) Frame = +3 Query: 183 FMPLSELYNPSRGYLVNDTCVIEAEVAVCKVVDYWSYDSKKETGYVGLKNQG 338 ++P+S + S YL N CV+ E ++ K ++ + K Y+ ++G Sbjct: 106 YVPVSVVDELSTEYLKNFKCVVVTETSLTKQLEINDFTHKNHIAYIAADSRG 157
>UBP6_HUMAN (P35125) Ubiquitin carboxyl-terminal hydrolase 6 (EC 3.1.2.15)| (Ubiquitin thioesterase 6) (Ubiquitin-specific-processing protease 6) (Deubiquitinating enzyme 6) (Proto-oncogene TRE-2) Length = 1406 Score = 28.9 bits (63), Expect = 6.7 Identities = 12/21 (57%), Positives = 14/21 (66%) Frame = +3 Query: 306 ETGYVGLKNQGATCYMNSLLQ 368 E G GL N G TC+MNS +Q Sbjct: 528 EKGATGLSNLGNTCFMNSSIQ 548
>CATL_FELCA (P25773) Cathepsin L (EC 3.4.22.15) (Progesterone-dependent| protein) (PDP) (Fragment) Length = 139 Score = 28.9 bits (63), Expect = 6.7 Identities = 16/67 (23%), Positives = 33/67 (49%), Gaps = 1/67 (1%) Frame = +3 Query: 234 DTCVIEAEVAVCKVVDYWSYDSKKETGYVGLKNQG-ATCYMNSLLQTLYHIPYFRKAVYH 410 D+C E +V V DYW SK+ + L G + +++ L T ++++ +Y+ Sbjct: 30 DSCKYRPENSVANVTDYWDIPSKENELMITLAAVGPISAAIDASLDT---FRFYKEGIYY 86 Query: 411 MPTTEND 431 P+ ++ Sbjct: 87 DPSCSSE 93
>UBP18_MOUSE (Q9WTV6) Ubl carboxyl-terminal hydrolase 18 (EC 3.1.2.-) (Ubl| thioesterase 18) (ISG15-specific-processing protease) (43 kDa ISG15-specific protease) Length = 368 Score = 28.9 bits (63), Expect = 6.7 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = +3 Query: 312 GYVGLKNQGATCYMNSLLQ 368 G VGL N G TC +NSLLQ Sbjct: 50 GLVGLHNIGQTCCLNSLLQ 68
>GUP1_MOUSE (Q9D1G3) Glycerol uptake/transporter homolog| Length = 503 Score = 28.9 bits (63), Expect = 6.7 Identities = 26/107 (24%), Positives = 45/107 (42%) Frame = -2 Query: 392 EIWNVIESLKERIHIASGTLVFEANIASLLFRVITPIINNLTHGNLCFYYTSIIYKIAST 213 E+W ++ L ER +A EA ++ + R + + + ++ I+Y + S Sbjct: 399 ELW--VQKLAERGPLAQ----IEARLSEQMSRRVRALCGAVN------FWAIIMYNLVSL 446 Query: 212 GIVEFTQRHKRSETPVAFSSRELMLCFFSYCKLVVNLVNH*EAELCI 72 +EFT+ R F L + F +YC V LV E L + Sbjct: 447 NSLEFTELVARRLILTGFPQTTLAVLFVTYCG--VQLVKERERSLAL 491
>UBP16_YEAST (Q02863) Ubiquitin carboxyl-terminal hydrolase 16 (EC 3.1.2.15)| (Ubiquitin thioesterase 16) (Ubiquitin-specific-processing protease 16) (Deubiquitinating enzyme 16) Length = 499 Score = 28.9 bits (63), Expect = 6.7 Identities = 17/36 (47%), Positives = 21/36 (58%), Gaps = 3/36 (8%) Frame = +3 Query: 294 DSKKETGY---VGLKNQGATCYMNSLLQTLYHIPYF 392 DSK+ G VGL N+G C++ S LQ L IP F Sbjct: 42 DSKQSIGKYTTVGLINRGNDCFITSSLQGLAGIPRF 77
>PMPE_CHLTR (O84877) Probable outer membrane protein pmpE precursor| (Polymorphic membrane protein E) Length = 964 Score = 28.5 bits (62), Expect = 8.7 Identities = 12/45 (26%), Positives = 24/45 (53%) Frame = -2 Query: 239 SIIYKIASTGIVEFTQRHKRSETPVAFSSRELMLCFFSYCKLVVN 105 S+++ A+ +F QR+ +++TP + LC + +L VN Sbjct: 429 SVVFSGATVNSADFHQRNLQTKTPAPLTLSNGFLCIEDHAQLTVN 473
>UBP18_HUMAN (Q9UMW8) Ubl carboxyl-terminal hydrolase 18 (EC 3.1.2.-) (Ubl| thioesterase 18) (ISG15-specific-processing protease) (43 kDa ISG15-specific protease) (hUBP43) Length = 372 Score = 28.5 bits (62), Expect = 8.7 Identities = 14/28 (50%), Positives = 16/28 (57%) Frame = +3 Query: 285 WSYDSKKETGYVGLKNQGATCYMNSLLQ 368 W Y G VGL N G TC +NSL+Q Sbjct: 48 WDYPH----GLVGLHNIGQTCCLNSLIQ 71
>KP58_DROME (Q9VPC0) Serine/threonine-protein kinase PITSLRE (EC 2.7.11.22)| (Cell division cycle 2-like) Length = 952 Score = 28.5 bits (62), Expect = 8.7 Identities = 16/49 (32%), Positives = 20/49 (40%) Frame = -1 Query: 378 DRESEGENSYSKWHLGF*GQHSQSPF*SHNSNNQQPYTRQPLLLLHKYH 232 +R S +Y+K HLG + Q P QQP P H YH Sbjct: 99 ERSSNAAAAYAKHHLGHAYHYPQPP-----QQQQQPLPPAPSYAAHHYH 142
>UBP3_SCHPO (O94269) Probable ubiquitin carboxyl-terminal hydrolase 3 (EC| 3.1.2.15) (Ubiquitin thioesterase 3) (Ubiquitin-specific processing protease 3) (Deubiquitinating enzyme 3) Length = 512 Score = 28.5 bits (62), Expect = 8.7 Identities = 14/36 (38%), Positives = 21/36 (58%), Gaps = 1/36 (2%) Frame = +3 Query: 288 SYDSKKETGYVGLKNQGATCYMNSLLQTL-YHIPYF 392 S D+ + G N G C+MNS+LQ L Y +P++ Sbjct: 123 SLDAPRPIQPRGFINTGNICFMNSILQALMYCVPFY 158
>RPOB_GLUOX (Q5FTX7) DNA-directed RNA polymerase beta chain (EC 2.7.7.6) (RNAP| beta subunit) (Transcriptase beta chain) (RNA polymerase beta subunit) Length = 1390 Score = 28.5 bits (62), Expect = 8.7 Identities = 14/54 (25%), Positives = 26/54 (48%) Frame = -2 Query: 422 SSGHMINRLSEIWNVIESLKERIHIASGTLVFEANIASLLFRVITPIINNLTHG 261 S G M++ + L +R+H G ++F ++A+L + + NNL G Sbjct: 1172 SIGDMVDEYQRTGERKQELLDRLHEVYGDVIFNEDVATLPNEQLIELANNLRKG 1225 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 62,953,614 Number of Sequences: 219361 Number of extensions: 1199068 Number of successful extensions: 3173 Number of sequences better than 10.0: 109 Number of HSP's better than 10.0 without gapping: 3102 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3165 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2968155324 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)