| Clone Name | bastl53h08 |
|---|---|
| Clone Library Name | barley_pub |
>ANTR1_MOUSE (Q9CZ52) Anthrax toxin receptor 1 precursor (Tumor endothelial| marker 8) Length = 562 Score = 35.0 bits (79), Expect = 0.050 Identities = 14/23 (60%), Positives = 15/23 (65%) Frame = +2 Query: 50 SSPPPLPSTGAPRPAPHCSLPSP 118 SSPPP P P PAPHC P+P Sbjct: 502 SSPPPAPIYTPPPPAPHCPPPAP 524
>ANTR1_HUMAN (Q9H6X2) Anthrax toxin receptor 1 precursor (Tumor endothelial| marker 8) Length = 564 Score = 34.3 bits (77), Expect = 0.086 Identities = 14/23 (60%), Positives = 14/23 (60%) Frame = +2 Query: 50 SSPPPLPSTGAPRPAPHCSLPSP 118 SSPPP P P PAPHC P P Sbjct: 504 SSPPPAPIYTPPPPAPHCPPPPP 526
>ENAH_HUMAN (Q8N8S7) Protein enabled homolog| Length = 591 Score = 31.6 bits (70), Expect = 0.56 Identities = 13/20 (65%), Positives = 14/20 (70%) Frame = +2 Query: 56 PPPLPSTGAPRPAPHCSLPS 115 PPPLPSTG P P P LP+ Sbjct: 339 PPPLPSTGPPPPPPPPPLPN 358
>TWIST_CAEEL (Q11094) Twist-related protein (CeTwist) (Helix-loop-helix protein| 8) Length = 178 Score = 30.8 bits (68), Expect = 0.95 Identities = 14/29 (48%), Positives = 15/29 (51%), Gaps = 5/29 (17%) Frame = +2 Query: 50 SSPPPLPSTGAPRPAP-----HCSLPSPW 121 S PPL S P PAP HC +P PW Sbjct: 115 SQLPPLQSAHIPPPAPSSIPPHCLMPQPW 143
>ENAH_MOUSE (Q03173) Protein enabled homolog (NPC-derived proline-rich protein| 1) (NDPP-1) Length = 802 Score = 29.3 bits (64), Expect = 2.8 Identities = 11/14 (78%), Positives = 11/14 (78%) Frame = +2 Query: 56 PPPLPSTGAPRPAP 97 PPPLPSTG P P P Sbjct: 570 PPPLPSTGPPPPPP 583
>PRP28_ASPFU (Q4WPE9) Pre-mRNA splicing ATP-dependent RNA helicase prp28 (EC| 3.6.1.-) Length = 796 Score = 29.3 bits (64), Expect = 2.8 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = +2 Query: 44 DFSSPPPLPSTGAPRPAPHCSLPSP 118 D ++PPP P T P P P + P+P Sbjct: 35 DSAAPPPPPDTSVPPPPPEDAPPAP 59
>MKRN2_SERQU (Q9DD48) Makorin-2 (Zinc finger protein YGHLC3HC4)| Length = 423 Score = 29.3 bits (64), Expect = 2.8 Identities = 13/26 (50%), Positives = 16/26 (61%) Frame = +1 Query: 187 LCHLCGYKYASAHPSAKQRRAHRKNC 264 LC +CG + H S +QRRAH K C Sbjct: 189 LCEVCGLQVLHPHDS-EQRRAHEKMC 213
>AFAD_HUMAN (P55196) Afadin (AF-6 protein)| Length = 1816 Score = 28.9 bits (63), Expect = 3.6 Identities = 12/24 (50%), Positives = 14/24 (58%) Frame = +2 Query: 26 RPTLLVDFSSPPPLPSTGAPRPAP 97 RP L D+ P P P+ GAP P P Sbjct: 1668 RPPLPRDYEPPSPSPAPGAPPPPP 1691
>ZN306_HUMAN (Q9BRR0) Zinc finger protein 306 (Zinc finger protein 47 homolog)| (Zfp-47) (Zf47) (Zinc finger and SCAN domain-containing protein 13) Length = 538 Score = 28.9 bits (63), Expect = 3.6 Identities = 10/23 (43%), Positives = 14/23 (60%) Frame = +1 Query: 184 HLCHLCGYKYASAHPSAKQRRAH 252 H+CH CG +A + +K RR H Sbjct: 314 HICHECGKSFAQSSGLSKHRRIH 336
>FMN2_MOUSE (Q9JL04) Formin-2| Length = 1567 Score = 28.9 bits (63), Expect = 3.6 Identities = 13/28 (46%), Positives = 14/28 (50%) Frame = +2 Query: 29 PTLLVDFSSPPPLPSTGAPRPAPHCSLP 112 P +L PPPLP G P P P LP Sbjct: 890 PEMLPAPPQPPPLPGLGVPPPPPAPPLP 917 Score = 27.7 bits (60), Expect = 8.1 Identities = 10/14 (71%), Positives = 10/14 (71%) Frame = +2 Query: 56 PPPLPSTGAPRPAP 97 PPPLP G P PAP Sbjct: 1056 PPPLPGMGVPPPAP 1069
>WC1_NEUCR (Q01371) White collar 1 protein (WC1)| Length = 1167 Score = 28.5 bits (62), Expect = 4.7 Identities = 14/21 (66%), Positives = 14/21 (66%), Gaps = 1/21 (4%) Frame = +2 Query: 56 PPPLPS-TGAPRPAPHCSLPS 115 PPP PS T AP PAP S PS Sbjct: 329 PPPPPSVTNAPTPAPFTSTPS 349
>DOK2_MOUSE (O70469) Docking protein 2 (Downstream of tyrosine kinase 2)| (p56(dok-2)) (Dok-related protein) (Dok-R) (IL-four receptor-interacting protein) (FRIP) Length = 412 Score = 28.5 bits (62), Expect = 4.7 Identities = 17/34 (50%), Positives = 18/34 (52%), Gaps = 11/34 (32%) Frame = +2 Query: 50 SSPPPLPSTGA------PRPA-----PHCSLPSP 118 S PP LP+TG PRP PH SLPSP Sbjct: 253 SGPPSLPATGPMMPTVLPRPESPYSRPHDSLPSP 286
>NO20_MEDTR (P93329) Early nodulin 20 precursor (N-20)| Length = 268 Score = 28.5 bits (62), Expect = 4.7 Identities = 17/29 (58%), Positives = 17/29 (58%), Gaps = 6/29 (20%) Frame = +2 Query: 50 SSPPPLPSTGAPR---PAPH---CSLPSP 118 SSPPP PS PR P PH SLPSP Sbjct: 134 SSPPPPPSPPTPRSSTPIPHPPRRSLPSP 162
>IF2_NOCFA (Q5YSC6) Translation initiation factor IF-2| Length = 969 Score = 28.5 bits (62), Expect = 4.7 Identities = 14/39 (35%), Positives = 16/39 (41%) Frame = +2 Query: 2 AQAGRTRARPTLLVDFSSPPPLPSTGAPRPAPHCSLPSP 118 +Q R RP P P P+ G PRP P P P Sbjct: 185 SQPAPERERPAARPGPGGPRPGPAQGGPRPGPGQGAPRP 223
>FAK2_MOUSE (Q9QVP9) Protein tyrosine kinase 2 beta (EC 2.7.10.2) (Focal| adhesion kinase 2) (FADK 2) (Proline-rich tyrosine kinase 2) (Cell adhesion kinase beta) (CAK beta) (Calcium-dependent tyrosine kinase) (CADTK) (Related adhesion focal tyrosine kinas Length = 1009 Score = 28.1 bits (61), Expect = 6.2 Identities = 15/41 (36%), Positives = 20/41 (48%), Gaps = 3/41 (7%) Frame = +2 Query: 5 QAGRTRARPTLLVD---FSSPPPLPSTGAPRPAPHCSLPSP 118 Q R RP +++ F PPP PS RP P +L +P Sbjct: 693 QERNARYRPPKILEPTTFQEPPPKPSRPKYRPPPQTNLLAP 733
>PDC2_CANAL (O60035) Protein PDC2| Length = 836 Score = 27.7 bits (60), Expect = 8.1 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = +2 Query: 29 PTLLVDFSSPPPLPSTGAPRPAPHCSLPS 115 P + +SPPP P P P P S+PS Sbjct: 738 PLFMNSLTSPPPPPPVPVPVPVPVPSVPS 766
>SASH1_MOUSE (P59808) SAM and SH3 domain-containing protein 1| Length = 1230 Score = 27.7 bits (60), Expect = 8.1 Identities = 14/34 (41%), Positives = 17/34 (50%), Gaps = 1/34 (2%) Frame = +2 Query: 23 ARPTLLVDFSSP-PPLPSTGAPRPAPHCSLPSPW 121 A P D SP P PS+G +P C+ P PW Sbjct: 1010 ASPVSPSDCPSPREPRPSSGTEPGSPACTRPPPW 1043
>SPEN_DROME (Q8SX83) Protein split ends| Length = 5560 Score = 27.7 bits (60), Expect = 8.1 Identities = 15/31 (48%), Positives = 18/31 (58%) Frame = +2 Query: 2 AQAGRTRARPTLLVDFSSPPPLPSTGAPRPA 94 A +G T+ L F S PPLP+T AP PA Sbjct: 1698 ANSGPTKG---LQYPFPSHPPLPNTAAPPPA 1725
>SF01_MOUSE (Q64213) Splicing factor 1 (Zinc finger protein 162) (Transcription| factor ZFM1) (mZFM) (Zinc finger gene in MEN1 locus) (Mammalian branch point-binding protein mBBP) (BBP) (CW17) Length = 653 Score = 27.7 bits (60), Expect = 8.1 Identities = 12/22 (54%), Positives = 13/22 (59%) Frame = +2 Query: 56 PPPLPSTGAPRPAPHCSLPSPW 121 PPP P +G P P P LP PW Sbjct: 480 PPPPPPSGQPPPPPSGPLP-PW 500
>BAT2_MACMU (Q5TM26) Large proline-rich protein BAT2 (HLA-B-associated| transcript 2) Length = 2160 Score = 27.7 bits (60), Expect = 8.1 Identities = 12/23 (52%), Positives = 15/23 (65%) Frame = +2 Query: 50 SSPPPLPSTGAPRPAPHCSLPSP 118 ++PP PST AP PA LP+P Sbjct: 509 AAPPAAPSTPAPPPAVPKELPAP 531
>SF01_HUMAN (Q15637) Splicing factor 1 (Zinc finger protein 162) (Transcription| factor ZFM1) (Zinc finger gene in MEN1 locus) (Mammalian branch point-binding protein mBBP) (BBP) Length = 639 Score = 27.7 bits (60), Expect = 8.1 Identities = 12/22 (54%), Positives = 13/22 (59%) Frame = +2 Query: 56 PPPLPSTGAPRPAPHCSLPSPW 121 PPP P +G P P P LP PW Sbjct: 480 PPPPPPSGQPPPPPSGPLP-PW 500
>BAT2_HUMAN (P48634) Large proline-rich protein BAT2 (HLA-B-associated| transcript 2) Length = 2157 Score = 27.7 bits (60), Expect = 8.1 Identities = 12/23 (52%), Positives = 15/23 (65%) Frame = +2 Query: 50 SSPPPLPSTGAPRPAPHCSLPSP 118 ++PP PST AP PA LP+P Sbjct: 509 AAPPAAPSTPAPPPAVPKELPAP 531
>YQ5B_CAEEL (Q09254) Hypothetical protein C16C10.11| Length = 154 Score = 27.7 bits (60), Expect = 8.1 Identities = 13/35 (37%), Positives = 19/35 (54%) Frame = +2 Query: 14 RTRARPTLLVDFSSPPPLPSTGAPRPAPHCSLPSP 118 R+ RP F++PPP P+ AP P + P+P Sbjct: 16 RSAPRPAAQSSFAAPPPRPAAAAPAYHPPAA-PTP 49 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 19,716,472 Number of Sequences: 219361 Number of extensions: 242767 Number of successful extensions: 3150 Number of sequences better than 10.0: 23 Number of HSP's better than 10.0 without gapping: 2163 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3067 length of database: 80,573,946 effective HSP length: 63 effective length of database: 66,754,203 effective search space used: 1602100872 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)