| Clone Name | bastl53e05 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | PER1_MOUSE (O35973) Period circadian protein 1 (Circadian pacema... | 29 | 3.9 | 2 | PER1_HUMAN (O15534) Period circadian protein 1 (Circadian pacema... | 28 | 5.1 | 3 | DNBI_HCMVA (P17147) Major DNA-binding protein (MDBP) | 28 | 6.6 | 4 | MEFV_HUMAN (O15553) Pyrin (Marenostrin) | 28 | 6.6 |
|---|
>PER1_MOUSE (O35973) Period circadian protein 1 (Circadian pacemaker protein| Rigui) (mPER) (M-Rigui) Length = 1291 Score = 28.9 bits (63), Expect = 3.9 Identities = 13/22 (59%), Positives = 13/22 (59%), Gaps = 1/22 (4%) Frame = +3 Query: 108 HGPALPGRRPHCLPVLSR-RHH 170 HGP PGRR HC R RHH Sbjct: 821 HGPIPPGRRHHCRSKAKRSRHH 842
>PER1_HUMAN (O15534) Period circadian protein 1 (Circadian pacemaker protein| Rigui) (hPER) Length = 1290 Score = 28.5 bits (62), Expect = 5.1 Identities = 13/22 (59%), Positives = 13/22 (59%), Gaps = 1/22 (4%) Frame = +3 Query: 108 HGPALPGRRPHCLPVLSR-RHH 170 HGPA P RR HC R RHH Sbjct: 824 HGPAPPSRRHHCRSKAKRSRHH 845
>DNBI_HCMVA (P17147) Major DNA-binding protein (MDBP)| Length = 1235 Score = 28.1 bits (61), Expect = 6.6 Identities = 18/37 (48%), Positives = 20/37 (54%), Gaps = 1/37 (2%) Frame = -3 Query: 174 PSDGVWIGRGGNEGGGL-VMRGHGQRNLRASNPKARR 67 PSDG+ GRGG GG M G G R L AS + R Sbjct: 563 PSDGLGGGRGGGGGGDSGGMMGRGGRMLGASVDRTYR 599
>MEFV_HUMAN (O15553) Pyrin (Marenostrin)| Length = 781 Score = 28.1 bits (61), Expect = 6.6 Identities = 19/48 (39%), Positives = 22/48 (45%), Gaps = 1/48 (2%) Frame = -3 Query: 144 GNEGGGLVMRGHGQRNLRASNPKARRQL-RXXXXXXXXAEREGIREQG 4 GNEG G G G +LR S P+A R L R EG+ QG Sbjct: 126 GNEGNGPRPYGGGAASLRCSQPEAGRGLSRKPLSKRREKASEGLDAQG 173 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 21,746,542 Number of Sequences: 219361 Number of extensions: 305325 Number of successful extensions: 1040 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 963 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1036 length of database: 80,573,946 effective HSP length: 40 effective length of database: 71,799,506 effective search space used: 1723188144 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)