| Clone Name | bastl53c08 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | Y1618_THETN (Q8R9J2) UPF0078 membrane protein TTE1618 | 32 | 1.2 | 2 | METW_YEAST (Q12198) Putative cystathionine gamma-synthase YLL058... | 30 | 4.4 | 3 | XDHA_ECOLI (Q46799) Xanthine dehydrogenase molybdenum-binding su... | 28 | 9.7 | 4 | XDHA_ECO57 (Q8X6C7) Xanthine dehydrogenase molybdenum-binding su... | 28 | 9.7 |
|---|
>Y1618_THETN (Q8R9J2) UPF0078 membrane protein TTE1618| Length = 198 Score = 31.6 bits (70), Expect = 1.2 Identities = 21/62 (33%), Positives = 38/62 (61%), Gaps = 4/62 (6%) Frame = -2 Query: 468 VNVRCISMAILYLNIN---PERVQFLMDSCIMQVLVIVQH-DNIPILISVSENEVSIRAK 301 V++ ++ AI + +N P VQ L + ++ +LVI QH NI LI+ +E+++ RA+ Sbjct: 137 VSLGSMTGAITFALLNIFFPNSVQVLTFAIVLALLVIFQHRSNIKRLINGTESKIGQRAQ 196 Query: 300 LK 295 +K Sbjct: 197 IK 198
>METW_YEAST (Q12198) Putative cystathionine gamma-synthase YLL058W (EC| 2.5.1.48) (O-succinylhomoserine (thiol)-lyase) Length = 575 Score = 29.6 bits (65), Expect = 4.4 Identities = 18/43 (41%), Positives = 23/43 (53%), Gaps = 4/43 (9%) Frame = +1 Query: 208 DTLKRFNGYVNGTHFTLNLS----ALRSKIASAFKFGPDADFI 324 D+LK F G NGT+FTL A S++ KFG D + I Sbjct: 502 DSLKVFKGPSNGTNFTLACPYVHLAHHSELEEVSKFGADPNII 544
>XDHA_ECOLI (Q46799) Xanthine dehydrogenase molybdenum-binding subunit (EC| 1.17.1.4) Length = 752 Score = 28.5 bits (62), Expect = 9.7 Identities = 11/26 (42%), Positives = 20/26 (76%) Frame = -1 Query: 169 AEDAAIVWRGGSILEETKLAAGNLGQ 92 AEDAA + GG++L+++ ++ GN+ Q Sbjct: 136 AEDAAPIHNGGNLLKQSTMSTGNVQQ 161
>XDHA_ECO57 (Q8X6C7) Xanthine dehydrogenase molybdenum-binding subunit (EC| 1.17.1.4) Length = 752 Score = 28.5 bits (62), Expect = 9.7 Identities = 11/26 (42%), Positives = 20/26 (76%) Frame = -1 Query: 169 AEDAAIVWRGGSILEETKLAAGNLGQ 92 AEDAA + GG++L+++ ++ GN+ Q Sbjct: 136 AEDAAPIHNGGNLLKQSTMSTGNVQQ 161 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 51,708,746 Number of Sequences: 219361 Number of extensions: 875421 Number of successful extensions: 2928 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 2876 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2928 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3304846491 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)