| Clone Name | bastl53a07 |
|---|---|
| Clone Library Name | barley_pub |
>WIRE_HUMAN (Q8TF74) WIP-related protein (WASP-interacting protein-related| protein) (WIP-and CR16-homologous protein) Length = 440 Score = 30.8 bits (68), Expect = 1.9 Identities = 24/67 (35%), Positives = 27/67 (40%), Gaps = 8/67 (11%) Frame = -3 Query: 470 TSMSRNLLH----PSPRCPPVRGACRYQPS----NGRLGFRQPPQPLGQHSRRKPCRWQR 315 TS S +LL P R PP RGA P NG PP P H P R + Sbjct: 300 TSASPSLLSNRPPPPARDPPSRGAAPPPPPPVIRNGARDAPPPPPPYRMHGSEPPSRGKP 359 Query: 314 GGSPSRS 294 PSR+ Sbjct: 360 PPPPSRT 366
>WIRE_MOUSE (Q6PEV3) WIP-related protein (WASP-interacting protein-related| protein) Length = 440 Score = 30.0 bits (66), Expect = 3.2 Identities = 21/62 (33%), Positives = 24/62 (38%), Gaps = 4/62 (6%) Frame = -3 Query: 467 SMSRNLLHPSPRCPPVRGACRYQPS----NGRLGFRQPPQPLGQHSRRKPCRWQRGGSPS 300 S+ N P R PP RGA P NG PP P H P R + PS Sbjct: 305 SLLSNRPPPPAREPPSRGAAPPPPPPMIRNGARDAPPPPPPYRMHGSEPPSRGKPPPPPS 364 Query: 299 RS 294 R+ Sbjct: 365 RT 366
>ZEP2_HUMAN (P31629) Human immunodeficiency virus type I enhancer-binding protein| 2 (HIV-EP2) (MHC-binding protein 2) (MBP-2) Length = 2446 Score = 29.6 bits (65), Expect = 4.1 Identities = 18/51 (35%), Positives = 24/51 (47%), Gaps = 1/51 (1%) Frame = -3 Query: 449 LHPSPRCP-PVRGACRYQPSNGRLGFRQPPQPLGQHSRRKPCRWQRGGSPS 300 LHPSP P P+ G + ++G + P QH +R P Q G PS Sbjct: 2247 LHPSPTLPLPMEGFEEKKGASGESFSKDPYVLSKQHEKRGPHALQSSGPPS 2297
>ROA1_CAEEL (Q22037) Heterogeneous nuclear ribonucleoprotein A1| Length = 346 Score = 29.3 bits (64), Expect = 5.4 Identities = 12/26 (46%), Positives = 14/26 (53%) Frame = -3 Query: 125 GGWRWRSPAAMGSPGAWVSPAFGEEG 48 GG W PA G PGA+ P G +G Sbjct: 225 GGGGWGGPAQRGGPGAYGGPGGGGQG 250
>SALM_DROVI (P39806) Homeotic protein spalt-major| Length = 1402 Score = 28.9 bits (63), Expect = 7.1 Identities = 18/47 (38%), Positives = 20/47 (42%), Gaps = 7/47 (14%) Frame = -3 Query: 443 PSPRCPPVRGACR-----YQPSNGRLGF--RQPPQPLGQHSRRKPCR 324 P P C PVR +C + S G L R P PL S R P R Sbjct: 1092 PKPSCSPVRSSCSPVRSVSETSQGALDLTPRALPPPLASSSSRSPYR 1138
>RL3_MYCTU (P60442) 50S ribosomal protein L3| Length = 217 Score = 28.9 bits (63), Expect = 7.1 Identities = 18/48 (37%), Positives = 22/48 (45%), Gaps = 10/48 (20%) Frame = +1 Query: 322 QRHGFRRECC----------PSGCGGCRNPSRPFEGWYRHAPRTGGQR 435 +RHGFR + P GGC P+R F+G R A R G R Sbjct: 128 KRHGFRGQGASHGAQAVHRRPGSIGGCATPARVFKG-TRMAGRMGNDR 174
>RL3_MYCLE (P30762) 50S ribosomal protein L3| Length = 217 Score = 28.9 bits (63), Expect = 7.1 Identities = 18/48 (37%), Positives = 22/48 (45%), Gaps = 10/48 (20%) Frame = +1 Query: 322 QRHGFRRECC----------PSGCGGCRNPSRPFEGWYRHAPRTGGQR 435 +RHGFR + P GGC P+R F+G R A R G R Sbjct: 128 KRHGFRGQGASHGAQAVHRRPGSIGGCATPARVFKG-TRMAGRMGNDR 174
>RL3_MYCBO (P60441) 50S ribosomal protein L3| Length = 217 Score = 28.9 bits (63), Expect = 7.1 Identities = 18/48 (37%), Positives = 22/48 (45%), Gaps = 10/48 (20%) Frame = +1 Query: 322 QRHGFRRECC----------PSGCGGCRNPSRPFEGWYRHAPRTGGQR 435 +RHGFR + P GGC P+R F+G R A R G R Sbjct: 128 KRHGFRGQGASHGAQAVHRRPGSIGGCATPARVFKG-TRMAGRMGNDR 174
>ADA10_RAT (Q10743) ADAM 10 precursor (EC 3.4.24.81) (A disintegrin and| metalloproteinase domain 10) (Mammalian disintegrin-metalloprotease) (Kuzbanian protein homolog) (Fragment) Length = 544 Score = 28.9 bits (63), Expect = 7.1 Identities = 14/37 (37%), Positives = 21/37 (56%) Frame = -3 Query: 440 SPRCPPVRGACRYQPSNGRLGFRQPPQPLGQHSRRKP 330 +P+ PP + P G L R+PPQP+ Q R++P Sbjct: 503 NPKLPPPK------PLPGTLKRRRPPQPIQQPQRQRP 533
>ADA10_HUMAN (O14672) ADAM 10 precursor (EC 3.4.24.81) (A disintegrin and| metalloproteinase domain 10) (Mammalian disintegrin-metalloprotease) (Kuzbanian protein homolog) (CDw156c antigen) Length = 748 Score = 28.9 bits (63), Expect = 7.1 Identities = 14/37 (37%), Positives = 21/37 (56%) Frame = -3 Query: 440 SPRCPPVRGACRYQPSNGRLGFRQPPQPLGQHSRRKP 330 +P+ PP + P G L R+PPQP+ Q R++P Sbjct: 707 NPKLPPPK------PLPGTLKRRRPPQPIQQPQRQRP 737
>ADA10_BOVIN (Q10741) ADAM 10 precursor (EC 3.4.24.81) (A disintegrin and| metalloproteinase domain 10) (Mammalian disintegrin-metalloprotease) (Myelin-associated metalloproteinase) (Kuzbanian protein homolog) Length = 748 Score = 28.9 bits (63), Expect = 7.1 Identities = 14/37 (37%), Positives = 21/37 (56%) Frame = -3 Query: 440 SPRCPPVRGACRYQPSNGRLGFRQPPQPLGQHSRRKP 330 +P+ PP + P G L R+PPQP+ Q R++P Sbjct: 707 NPKLPPPK------PLPGTLKRRRPPQPIQQPQRQRP 737
>YN18_YEAST (P53836) Hypothetical 118.3 kDa protein in ERG24-MET2 intergenic| region Length = 1060 Score = 28.9 bits (63), Expect = 7.1 Identities = 11/24 (45%), Positives = 16/24 (66%) Frame = -3 Query: 401 QPSNGRLGFRQPPQPLGQHSRRKP 330 QP NG G+ +PP P Q+S+ +P Sbjct: 1016 QPQNGSAGYYRPPAPQLQNSQARP 1039
>ADA10_MOUSE (O35598) ADAM 10 precursor (EC 3.4.24.81) (A disintegrin and| metalloproteinase domain 10) (Mammalian desintegrin-metalloprotease) (Kuzbanian protein homolog) Length = 749 Score = 28.5 bits (62), Expect = 9.2 Identities = 14/37 (37%), Positives = 21/37 (56%) Frame = -3 Query: 440 SPRCPPVRGACRYQPSNGRLGFRQPPQPLGQHSRRKP 330 +P+ PP + P G L R+PPQP+ Q R++P Sbjct: 708 NPKLPPPK------PLPGTLKRRRPPQPIQQPPRQRP 738
>RABX5_HUMAN (Q9UJ41) Rab5 GDP/GTP exchange factor (Rabaptin 5-associated| exchange factor for Rab5) (Rabex-5) Length = 708 Score = 28.5 bits (62), Expect = 9.2 Identities = 20/57 (35%), Positives = 28/57 (49%), Gaps = 1/57 (1%) Frame = -3 Query: 443 PSPRCPPVRGACRYQPSNGR-LGFRQPPQPLGQHSRRKPCRWQRGGSPSRSRVMAVV 276 P+ R PP +GAC G L R PP G+H+ + R G+PS S A++ Sbjct: 54 PALRGPPTQGACSSCVQRGPVLCHRAPPGAAGEHAATE----GREGAPSVSGTHALL 106 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 53,852,749 Number of Sequences: 219361 Number of extensions: 962157 Number of successful extensions: 3474 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 3218 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3471 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3130907202 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)