| Clone Name | bastl50e08 |
|---|---|
| Clone Library Name | barley_pub |
>SREC2_HUMAN (Q96GP6) Scavenger receptor class F member 2 precursor (Scavenger| receptor expressed by endothelial cells 2 protein) (SREC-II) (SRECRP-1) Length = 866 Score = 30.8 bits (68), Expect = 1.6 Identities = 17/39 (43%), Positives = 21/39 (53%), Gaps = 10/39 (25%) Frame = -1 Query: 155 RARPPRPDP---------HG-HGAAWSGRTPWHPDPGTK 69 R +PP PDP HG H AA +GR P P PG++ Sbjct: 651 RRKPPPPDPATKPKVSWIHGKHSAAAAGRAPSPPPPGSE 689
>SPT5H_CHICK (Q5ZI08) Transcription elongation factor SPT5 (DRB| sensitivity-inducing factor large subunit) (DSIF large subunit) Length = 1079 Score = 30.4 bits (67), Expect = 2.1 Identities = 11/26 (42%), Positives = 16/26 (61%) Frame = -1 Query: 143 PRPDPHGHGAAWSGRTPWHPDPGTKQ 66 P P P G+G + +TP +PDP + Q Sbjct: 836 PTPSPQGYGGTPNPQTPGYPDPSSPQ 861
>ZN553_HUMAN (Q96MX3) Zinc finger protein 553| Length = 618 Score = 29.6 bits (65), Expect = 3.6 Identities = 17/42 (40%), Positives = 21/42 (50%), Gaps = 6/42 (14%) Frame = -3 Query: 129 PRPRGSLEWPH------PMAPRPRHQAKQFENLNVGDCGWCG 22 P P +L PH PMAPRPR +A+ CG+CG Sbjct: 508 PPPPSTLLRPHNPPGPVPMAPRPRVRAQPSGPSQPHVCGFCG 549
>PDCD7_HUMAN (Q8N8D1) Programmed cell death protein 7 (ES18) (HES18)| Length = 485 Score = 28.5 bits (62), Expect = 8.1 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -1 Query: 143 PRPDPHGHGAAWSGRTPWHPDP 78 PRP P G G WS R P P P Sbjct: 107 PRPPPPGPGPPWSPRWPEAPPP 128
>HNF4A_HUMAN (P41235) Hepatocyte nuclear factor 4-alpha (HNF-4-alpha)| (Transcription factor HNF-4) (Transcription factor 14) Length = 465 Score = 28.5 bits (62), Expect = 8.1 Identities = 15/37 (40%), Positives = 21/37 (56%) Frame = +1 Query: 16 PYPTPPAITNVEVFKLFCLVPGSGCHGVRPLQAAPWP 126 P P+PP + E +KL +PG+ V+PL A P P Sbjct: 424 PQPSPPGGSGSEPYKL---LPGAVATIVKPLSAIPQP 457
>GLUQ_NEIMA (Q9JST9) Glutamyl-Q tRNA(Asp) synthetase (EC 6.1.1.-) (Glu-Q-RSs)| Length = 295 Score = 28.5 bits (62), Expect = 8.1 Identities = 15/40 (37%), Positives = 18/40 (45%), Gaps = 7/40 (17%) Frame = -1 Query: 191 EWRRPAAR-------SGRCRARPPRPDPHGHGAAWSGRTP 93 +W+ A R +GRCR RP P G AW R P Sbjct: 103 DWQTGARRGADGFVYNGRCRNPQQRPAPQGKQPAWRIRVP 142 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 41,332,513 Number of Sequences: 219361 Number of extensions: 738497 Number of successful extensions: 2990 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 2821 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2986 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2735358828 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)