| Clone Name | bastl50c11 |
|---|---|
| Clone Library Name | barley_pub |
>PSD2_MOUSE (Q8VDM4) 26S proteasome non-ATPase regulatory subunit 2 (26S| proteasome regulatory subunit RPN1) (26S proteasome regulatory subunit S2) (26S proteasome subunit p97) Length = 908 Score = 51.6 bits (122), Expect = 5e-07 Identities = 25/44 (56%), Positives = 34/44 (77%) Frame = +1 Query: 223 QLELYVVRAQDVDPGVQRLALESMRQEIRSATSSMTSVPKPLKF 354 +LE+ V R + D + R ALE +R++IRS+T+SMTSVPKPLKF Sbjct: 55 ELEMLVERLGEKDTSLYRPALEELRRQIRSSTTSMTSVPKPLKF 98
>PSD2_HUMAN (Q13200) 26S proteasome non-ATPase regulatory subunit 2 (26S| proteasome regulatory subunit RPN1) (26S proteasome regulatory subunit S2) (26S proteasome subunit p97) (Tumor necrosis factor type 1 receptor-associated protein 2) (55.11 protein) Length = 908 Score = 51.6 bits (122), Expect = 5e-07 Identities = 25/44 (56%), Positives = 34/44 (77%) Frame = +1 Query: 223 QLELYVVRAQDVDPGVQRLALESMRQEIRSATSSMTSVPKPLKF 354 +LE+ V R + D + R ALE +R++IRS+T+SMTSVPKPLKF Sbjct: 55 ELEMLVERLGEKDTSLYRPALEELRRQIRSSTTSMTSVPKPLKF 98
>RPN1_YEAST (P38764) 26S proteasome regulatory subunit RPN1 (Proteasome| non-ATPase subunit 1) Length = 992 Score = 44.7 bits (104), Expect = 6e-05 Identities = 20/43 (46%), Positives = 32/43 (74%) Frame = +1 Query: 226 LELYVVRAQDVDPGVQRLALESMRQEIRSATSSMTSVPKPLKF 354 LEL V R ++ D + +L ++++ I+++TSSMT+VPKPLKF Sbjct: 48 LELLVERLKEDDSSLYEASLNALKESIKNSTSSMTAVPKPLKF 90
>RPN1_SCHPO (P87048) 26S proteasome regulatory subunit rpn1 (Proteasome| non-ATPase subunit mts4) (19S regulatory cap region of 26S protease subunit 2) Length = 891 Score = 44.3 bits (103), Expect = 7e-05 Identities = 22/43 (51%), Positives = 30/43 (69%) Frame = +1 Query: 226 LELYVVRAQDVDPGVQRLALESMRQEIRSATSSMTSVPKPLKF 354 LEL V QD P + +L +++ IR++TSSMT+VPKPLKF Sbjct: 57 LELLVQAVQDATPELVGSSLTQLKEIIRTSTSSMTAVPKPLKF 99
>RPN1_NEUCR (Q7S8R8) 26S proteasome regulatory subunit rpn-1| Length = 883 Score = 42.4 bits (98), Expect = 3e-04 Identities = 19/35 (54%), Positives = 28/35 (80%) Frame = +1 Query: 250 QDVDPGVQRLALESMRQEIRSATSSMTSVPKPLKF 354 Q+ D + + ALE+M+ I+++TSSMT+VPKPLKF Sbjct: 48 QESDATLYKPALEAMKNSIKTSTSSMTAVPKPLKF 82
>RPN1_CANGA (Q6FPV6) 26S proteasome regulatory subunit RPN1| Length = 983 Score = 37.4 bits (85), Expect = 0.009 Identities = 18/43 (41%), Positives = 28/43 (65%) Frame = +1 Query: 226 LELYVVRAQDVDPGVQRLALESMRQEIRSATSSMTSVPKPLKF 354 LE+ V + D + L +++ I+++TSSMT+VPKPLKF Sbjct: 49 LEMLVQTLLEDDSKLYETTLTQLKEFIKNSTSSMTAVPKPLKF 91
>YACF_SALTY (P67693) UPF0289 protein yacF| Length = 247 Score = 28.1 bits (61), Expect = 5.6 Identities = 11/27 (40%), Positives = 20/27 (74%) Frame = +1 Query: 262 PGVQRLALESMRQEIRSATSSMTSVPK 342 PGV + +E++RQ+++SA S + S P+ Sbjct: 81 PGVDQDRIEALRQQLKSAGSVLISAPR 107
>YACF_SALTI (P67694) UPF0289 protein yacF| Length = 247 Score = 28.1 bits (61), Expect = 5.6 Identities = 11/27 (40%), Positives = 20/27 (74%) Frame = +1 Query: 262 PGVQRLALESMRQEIRSATSSMTSVPK 342 PGV + +E++RQ+++SA S + S P+ Sbjct: 81 PGVDQDRIEALRQQLKSAGSVLISAPR 107
>YACF_SALPA (Q5PDD7) UPF0289 protein yacF| Length = 247 Score = 28.1 bits (61), Expect = 5.6 Identities = 11/27 (40%), Positives = 20/27 (74%) Frame = +1 Query: 262 PGVQRLALESMRQEIRSATSSMTSVPK 342 PGV + +E++RQ+++SA S + S P+ Sbjct: 81 PGVDQDRIEALRQQLKSAGSVLISAPR 107
>DMF1_SCHPO (P78953) Division mal foutue 1 protein| Length = 920 Score = 27.7 bits (60), Expect = 7.3 Identities = 12/38 (31%), Positives = 23/38 (60%) Frame = +1 Query: 229 ELYVVRAQDVDPGVQRLALESMRQEIRSATSSMTSVPK 342 ELY+ +++ +P + + +S++QE S TS+PK Sbjct: 357 ELYLQSSRNSEPEISTIINDSLQQENMDEDISATSIPK 394
>SALA_DROSI (P21749) Protein spalt-accessory precursor| Length = 139 Score = 27.3 bits (59), Expect = 9.5 Identities = 11/22 (50%), Positives = 14/22 (63%) Frame = -1 Query: 66 HGWRGGFGSATALAGWLGFGGR 1 +G +GGFG L G GFGG+ Sbjct: 25 YGGQGGFGGFGGLGGQAGFGGQ 46
>SALA_DROOR (P21748) Protein spalt-accessory precursor| Length = 142 Score = 27.3 bits (59), Expect = 9.5 Identities = 11/22 (50%), Positives = 14/22 (63%) Frame = -1 Query: 66 HGWRGGFGSATALAGWLGFGGR 1 +G +GGFG L G GFGG+ Sbjct: 28 YGGQGGFGGYGGLGGQAGFGGQ 49 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.311 0.128 0.348 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 25,707,299 Number of Sequences: 219361 Number of extensions: 231053 Number of successful extensions: 774 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 742 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 774 length of database: 80,573,946 effective HSP length: 93 effective length of database: 60,173,373 effective search space used: 1444160952 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.8 bits)