| Clone Name | bastl50c01 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | LPXK_RHIME (Q92RP7) Tetraacyldisaccharide 4'-kinase (EC 2.7.1.13... | 29 | 2.6 | 2 | HAD_AGRTR (P60527) 2-haloalkanoic acid dehalogenase (EC 3.8.1.2)... | 28 | 7.7 | 3 | CAPP_STRAW (Q82HE3) Phosphoenolpyruvate carboxylase (EC 4.1.1.31... | 28 | 7.7 |
|---|
>LPXK_RHIME (Q92RP7) Tetraacyldisaccharide 4'-kinase (EC 2.7.1.130) (Lipid A| 4'-kinase) Length = 346 Score = 29.3 bits (64), Expect = 2.6 Identities = 14/27 (51%), Positives = 18/27 (66%) Frame = +3 Query: 111 ARSRGFRGAWISRGGGFSHDVAVVYQP 191 AR+RG + A++SRG G S DV V P Sbjct: 71 ARARGLKPAFLSRGYGGSLDVTTVVDP 97
>HAD_AGRTR (P60527) 2-haloalkanoic acid dehalogenase (EC 3.8.1.2)| (L-2-haloacid dehalogenase) (Halocarboxylic acid halidohydrolase) (L-DEX) (Cryptic L-isomer-specific dehalogenase) (DhlS5I) Length = 232 Score = 27.7 bits (60), Expect = 7.7 Identities = 12/21 (57%), Positives = 14/21 (66%) Frame = +3 Query: 93 GSDQSGARSRGFRGAWISRGG 155 G D +GAR GF WI+RGG Sbjct: 178 GWDATGARYFGFPTCWINRGG 198
>CAPP_STRAW (Q82HE3) Phosphoenolpyruvate carboxylase (EC 4.1.1.31) (PEPCase)| (PEPC) Length = 910 Score = 27.7 bits (60), Expect = 7.7 Identities = 19/41 (46%), Positives = 25/41 (60%), Gaps = 2/41 (4%) Frame = +3 Query: 75 RRLDQIGSDQSGARSRGF--RGAWISRGGGFSHDVAVVYQP 191 RRL + + + G R R F RG + RGGG SHD A++ QP Sbjct: 584 RRLRDV-AHRYGVRLRLFHGRGGTVGRGGGPSHD-AILAQP 622 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.314 0.126 0.344 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 29,243,713 Number of Sequences: 219361 Number of extensions: 410268 Number of successful extensions: 1015 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1002 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1015 length of database: 80,573,946 effective HSP length: 76 effective length of database: 63,902,510 effective search space used: 1533660240 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits)