| Clone Name | bastl47f08 |
|---|---|
| Clone Library Name | barley_pub |
>UBP15_YEAST (P50101) Ubiquitin carboxyl-terminal hydrolase 15 (EC 3.1.2.15)| (Ubiquitin thioesterase 15) (Ubiquitin-specific-processing protease 15) (Deubiquitinating enzyme 15) Length = 1230 Score = 58.9 bits (141), Expect = 3e-09 Identities = 24/66 (36%), Positives = 45/66 (68%) Frame = +2 Query: 83 VQDLFRGSVSHVTRCSSCGRDSDASSKMEDFYELELNIKGLSNLEESLDDYLSVEALNGE 262 + ++F G + +C + +S +++EDF++L+LN+K NL+ES D+Y+ +E +NGE Sbjct: 311 LNEIFVGKMKSYIKCINVDYES---ARVEDFWDLQLNVKNFKNLQESFDNYIEMELMNGE 367 Query: 263 NQYSCE 280 NQY+ + Sbjct: 368 NQYAAQ 373
>UBP21_SCHPO (Q9UTT1) Ubiquitin carboxyl-terminal hydrolase 21 (EC 3.1.2.15)| (Ubiquitin thioesterase 21) (Ubiquitin-specific processing protease 21) (Deubiquitinating enzyme 21) Length = 1129 Score = 54.7 bits (130), Expect = 6e-08 Identities = 24/66 (36%), Positives = 41/66 (62%) Frame = +2 Query: 83 VQDLFRGSVSHVTRCSSCGRDSDASSKMEDFYELELNIKGLSNLEESLDDYLSVEALNGE 262 + D+F G + +C +S S++EDF++++LN+KG+ LE+S D + VE L G+ Sbjct: 336 LNDIFVGKMKSYVKCIDVNYES---SRVEDFWDIQLNVKGMDTLEDSFRDAIQVETLTGD 392 Query: 263 NQYSCE 280 N+Y E Sbjct: 393 NKYYAE 398
>UBP7_HUMAN (Q93009) Ubiquitin carboxyl-terminal hydrolase 7 (EC 3.1.2.15)| (Ubiquitin thioesterase 7) (Ubiquitin-specific-processing protease 7) (Deubiquitinating enzyme 7) (Herpesvirus-associated ubiquitin-specific protease) Length = 1102 Score = 52.8 bits (125), Expect = 2e-07 Identities = 25/63 (39%), Positives = 40/63 (63%) Frame = +2 Query: 83 VQDLFRGSVSHVTRCSSCGRDSDASSKMEDFYELELNIKGLSNLEESLDDYLSVEALNGE 262 + LFRG + +C SD + ED+Y+++L+IKG N+ ES DY++VE L+G+ Sbjct: 320 IPKLFRGKMVSYIQCKEVDYRSD---RREDYYDIQLSIKGKKNIFESFVDYVAVEQLDGD 376 Query: 263 NQY 271 N+Y Sbjct: 377 NKY 379
>UBP5_SCHPO (Q09879) Probable ubiquitin carboxyl-terminal hydrolase 5 (EC| 3.1.2.15) (Ubiquitin thioesterase 5) (Ubiquitin-specific processing protease 5) (Deubiquitinating enzyme 5) Length = 1108 Score = 49.3 bits (116), Expect = 3e-06 Identities = 22/61 (36%), Positives = 38/61 (62%) Frame = +2 Query: 89 DLFRGSVSHVTRCSSCGRDSDASSKMEDFYELELNIKGLSNLEESLDDYLSVEALNGENQ 268 +LF G + C + +S ++ ED+++++LN+KG+ NLE+S Y+ VE L G+N Sbjct: 321 NLFVGKMKSYIACVNVNFES---ARSEDYWDIQLNVKGMKNLEDSFRSYIQVETLEGDNC 377 Query: 269 Y 271 Y Sbjct: 378 Y 378
>UBP46_MOUSE (P62069) Ubiquitin carboxyl-terminal hydrolase 46 (EC 3.1.2.15)| (Ubiquitin thioesterase 46) (Ubiquitin-specific-processing protease 46) (Deubiquitinating enzyme 46) Length = 366 Score = 48.1 bits (113), Expect = 6e-06 Identities = 23/68 (33%), Positives = 42/68 (61%) Frame = +2 Query: 77 TIVQDLFRGSVSHVTRCSSCGRDSDASSKMEDFYELELNIKGLSNLEESLDDYLSVEALN 256 T V ++F+G++++ TRC +C SSK EDF +L ++++ +++ L D+ + E L Sbjct: 166 TWVHEIFQGTLTNETRCLNC---ETVSSKDEDFLDLSVDVEQNTSITHCLRDFSNTETLC 222 Query: 257 GENQYSCE 280 E +Y CE Sbjct: 223 SEQKYYCE 230
>UBP46_HUMAN (P62068) Ubiquitin carboxyl-terminal hydrolase 46 (EC 3.1.2.15)| (Ubiquitin thioesterase 46) (Ubiquitin-specific-processing protease 46) (Deubiquitinating enzyme 46) Length = 366 Score = 48.1 bits (113), Expect = 6e-06 Identities = 23/68 (33%), Positives = 42/68 (61%) Frame = +2 Query: 77 TIVQDLFRGSVSHVTRCSSCGRDSDASSKMEDFYELELNIKGLSNLEESLDDYLSVEALN 256 T V ++F+G++++ TRC +C SSK EDF +L ++++ +++ L D+ + E L Sbjct: 166 TWVHEIFQGTLTNETRCLNC---ETVSSKDEDFLDLSVDVEQNTSITHCLRDFSNTETLC 222 Query: 257 GENQYSCE 280 E +Y CE Sbjct: 223 SEQKYYCE 230
>UBPX_CAEEL (P34547) Probable ubiquitin carboxyl-terminal hydrolase R10E11.3| (EC 3.1.2.15) (Ubiquitin thioesterase) (Ubiquitin-specific processing protease) (Deubiquitinating enzyme) Length = 410 Score = 45.8 bits (107), Expect = 3e-05 Identities = 22/68 (32%), Positives = 40/68 (58%) Frame = +2 Query: 77 TIVQDLFRGSVSHVTRCSSCGRDSDASSKMEDFYELELNIKGLSNLEESLDDYLSVEALN 256 T + ++F+G +++ TRC SC SSK EDF +L ++++ +++ L + E L Sbjct: 195 TWIHEIFQGILTNETRCLSC---ETVSSKDEDFLDLSIDVEQNTSISHCLRVFSETETLC 251 Query: 257 GENQYSCE 280 G+ +Y CE Sbjct: 252 GDQKYFCE 259
>UBP12_HUMAN (O75317) Ubiquitin carboxyl-terminal hydrolase 12 (EC 3.1.2.15)| (Ubiquitin thioesterase 12) (Ubiquitin-specific-processing protease 12) (Deubiquitinating enzyme 12) (Ubiquitin hydrolyzing enzyme 1) Length = 355 Score = 44.3 bits (103), Expect = 8e-05 Identities = 22/68 (32%), Positives = 41/68 (60%) Frame = +2 Query: 77 TIVQDLFRGSVSHVTRCSSCGRDSDASSKMEDFYELELNIKGLSNLEESLDDYLSVEALN 256 T V ++F+G++++ TRC +C SSK EDF +L ++++ +++ L + + E L Sbjct: 155 TWVHEIFQGTLTNETRCLTC---ETISSKDEDFLDLSVDVEQNTSITHCLRGFSNTETLC 211 Query: 257 GENQYSCE 280 E +Y CE Sbjct: 212 SEYKYYCE 219
>UBP10_YEAST (P53874) Ubiquitin carboxyl-terminal hydrolase 10 (EC 3.1.2.15)| (Ubiquitin thioesterase 10) (Ubiquitin-specific-processing protease 10) (Deubiquitinating enzyme 10) (Disrupter of telomere silencing protein 4) Length = 792 Score = 42.0 bits (97), Expect = 4e-04 Identities = 21/62 (33%), Positives = 36/62 (58%) Frame = +2 Query: 74 KTIVQDLFRGSVSHVTRCSSCGRDSDASSKMEDFYELELNIKGLSNLEESLDDYLSVEAL 253 ++I+ D+F G + + C SCG S + FY+L L++KG L+ + D LS +++ Sbjct: 483 ESIIYDIFGGLLKQIVTCKSCG---SISKTEQPFYDLSLHLKGKKKLDPNSD--LSSDSI 537 Query: 254 NG 259 NG Sbjct: 538 NG 539
>UBP42_HUMAN (Q9H9J4) Ubiquitin carboxyl-terminal hydrolase 42 (EC 3.1.2.15)| (Ubiquitin thioesterase 42) (Ubiquitin-specific-processing protease 42) (Deubiquitinating enzyme 42) Length = 1325 Score = 42.0 bits (97), Expect = 4e-04 Identities = 20/69 (28%), Positives = 37/69 (53%) Frame = +2 Query: 71 AKTIVQDLFRGSVSHVTRCSSCGRDSDASSKMEDFYELELNIKGLSNLEESLDDYLSVEA 250 A T+V +F G + +C +C SD + + ++ L IK ++ ++L+ ++ E Sbjct: 226 ATTLVCQIFGGYLRSRVKCLNCKGVSDT---FDPYLDITLEIKAAQSVNKALEQFVKPEQ 282 Query: 251 LNGENQYSC 277 L+GEN Y C Sbjct: 283 LDGENSYKC 291
>UBP3_ARATH (O24454) Ubiquitin carboxyl-terminal hydrolase 3 (EC 3.1.2.15)| (Ubiquitin thioesterase 3) (Ubiquitin-specific-processing protease 3) (Deubiquitinating enzyme 3) (AtUBP3) Length = 371 Score = 41.2 bits (95), Expect = 7e-04 Identities = 20/68 (29%), Positives = 41/68 (60%) Frame = +2 Query: 77 TIVQDLFRGSVSHVTRCSSCGRDSDASSKMEDFYELELNIKGLSNLEESLDDYLSVEALN 256 T V ++F+G +++ TRC C +++ E F +L L+I+ S++ L ++ S E L+ Sbjct: 170 TWVHNIFQGILTNETRCLRC---ETVTARDETFLDLSLDIEQNSSITSCLKNFSSTETLH 226 Query: 257 GENQYSCE 280 E+++ C+ Sbjct: 227 AEDKFFCD 234
>UBP36_HUMAN (Q9P275) Ubiquitin carboxyl-terminal hydrolase 36 (EC 3.1.2.15)| (Ubiquitin thioesterase 36) (Ubiquitin-specific-processing protease 36) (Deubiquitinating enzyme 36) Length = 1121 Score = 41.2 bits (95), Expect = 7e-04 Identities = 20/69 (28%), Positives = 37/69 (53%) Frame = +2 Query: 71 AKTIVQDLFRGSVSHVTRCSSCGRDSDASSKMEDFYELELNIKGLSNLEESLDDYLSVEA 250 A T+V +F G + +CS C SD + + ++ L I+ +N+ +L+ ++ + Sbjct: 237 ATTLVHQIFGGYLRSRVKCSVCKSVSDT---YDPYLDVALEIRQAANIVRALELFVKADV 293 Query: 251 LNGENQYSC 277 L+GEN Y C Sbjct: 294 LSGENAYMC 302
>UBP4_ARATH (Q8LAM0) Ubiquitin carboxyl-terminal hydrolase 4 (EC 3.1.2.15)| (Ubiquitin thioesterase 4) (Ubiquitin-specific-processing protease 4) (Deubiquitinating enzyme 4) (AtUBP4) Length = 365 Score = 40.4 bits (93), Expect = 0.001 Identities = 20/68 (29%), Positives = 40/68 (58%) Frame = +2 Query: 77 TIVQDLFRGSVSHVTRCSSCGRDSDASSKMEDFYELELNIKGLSNLEESLDDYLSVEALN 256 T V +F+G +++ TRC C +++ E F +L L+I+ S++ L ++ S E L+ Sbjct: 165 TWVHKIFQGILTNETRCLRC---ETVTARDETFLDLSLDIEQNSSITSCLKNFSSTETLH 221 Query: 257 GENQYSCE 280 E+++ C+ Sbjct: 222 AEDKFFCD 229
>UBP47_HUMAN (Q96K76) Ubiquitin carboxyl-terminal hydrolase 47 (EC 3.1.2.15)| (Ubiquitin thioesterase 47) (Ubiquitin-specific-processing protease 47) (Deubiquitinating enzyme 47) Length = 1375 Score = 39.7 bits (91), Expect = 0.002 Identities = 19/73 (26%), Positives = 40/73 (54%), Gaps = 6/73 (8%) Frame = +2 Query: 80 IVQDLFRGSVSHVTRCSSCGRDSDASSKMEDFYELELNIK------GLSNLEESLDDYLS 241 ++ +L++G + RC CG + +++ + ++ L I+ +++EE+L ++ Sbjct: 296 LINELYQGKLKDYVRCLECGYEG---WRIDTYLDIPLVIRPYGSSQAFASVEEALHAFIQ 352 Query: 242 VEALNGENQYSCE 280 E L+G NQY CE Sbjct: 353 PEILDGPNQYFCE 365
>UBP47_MOUSE (Q8BY87) Ubiquitin carboxyl-terminal hydrolase 47 (EC 3.1.2.15)| (Ubiquitin thioesterase 47) (Ubiquitin-specific-processing protease 47) (Deubiquitinating enzyme 47) Length = 1376 Score = 39.7 bits (91), Expect = 0.002 Identities = 19/73 (26%), Positives = 40/73 (54%), Gaps = 6/73 (8%) Frame = +2 Query: 80 IVQDLFRGSVSHVTRCSSCGRDSDASSKMEDFYELELNIK------GLSNLEESLDDYLS 241 ++ +L++G + RC CG + +++ + ++ L I+ +++EE+L ++ Sbjct: 296 LINELYQGKLKDYVRCLECGYEG---WRIDTYLDIPLVIRPYGSSQAFASVEEALHAFIQ 352 Query: 242 VEALNGENQYSCE 280 E L+G NQY CE Sbjct: 353 PEILDGPNQYFCE 365
>UBP9_SCHPO (Q9P7V9) Probable ubiquitin carboxyl-terminal hydrolase 9 (EC| 3.1.2.15) (Ubiquitin thioesterase 9) (Ubiquitin-specific processing protease 9) (Deubiquitinating enzyme 9) Length = 585 Score = 38.5 bits (88), Expect = 0.004 Identities = 17/66 (25%), Positives = 39/66 (59%) Frame = +2 Query: 83 VQDLFRGSVSHVTRCSSCGRDSDASSKMEDFYELELNIKGLSNLEESLDDYLSVEALNGE 262 V LF G+++ T+C +C + +S+ E F +L ++I+ +++ L + + E L+ + Sbjct: 230 VHSLFEGTLTSETKCLTC---ENITSRDESFLDLSIDIENHTSVTSCLRSFSASEMLSSK 286 Query: 263 NQYSCE 280 N++ C+ Sbjct: 287 NKFHCD 292
>UBP24_HUMAN (Q9UPU5) Ubiquitin carboxyl-terminal hydrolase 24 (EC 3.1.2.15)| (Ubiquitin thioesterase 24) (Ubiquitin-specific-processing protease 24) (Deubiquitinating enzyme 24) Length = 1870 Score = 38.1 bits (87), Expect = 0.006 Identities = 22/67 (32%), Positives = 31/67 (46%) Frame = +2 Query: 80 IVQDLFRGSVSHVTRCSSCGRDSDASSKMEDFYELELNIKGLSNLEESLDDYLSVEALNG 259 I ++ F+G S C C + + E F L L + +LE SLD ++ E L G Sbjct: 1047 IFKNTFQGIYSDQKICKDCPHRYE---REEAFMALNLGVTSCQSLEISLDQFVRGEVLEG 1103 Query: 260 ENQYSCE 280 N Y CE Sbjct: 1104 SNAYYCE 1110
>UBPE_DROME (Q24574) Ubiquitin carboxyl-terminal hydrolase 64E (EC 3.1.2.15)| (Ubiquitin thioesterase 64E) (Ubiquitin-specific-processing protease 64E) (Deubiquitinating enzyme 64E) Length = 1556 Score = 37.4 bits (85), Expect = 0.010 Identities = 17/73 (23%), Positives = 38/73 (52%), Gaps = 6/73 (8%) Frame = +2 Query: 80 IVQDLFRGSVSHVTRCSSCGRDSDASSKMEDFYELELNIK------GLSNLEESLDDYLS 241 ++ +L+ G ++ +C C + ++ + F ++ L ++ ++EE+L ++ Sbjct: 502 LISNLYEGKMNDYVKCLECNTEK---TREDTFLDIPLPVRPFGSSSAYGSIEEALRAFVQ 558 Query: 242 VEALNGENQYSCE 280 E L+G NQY CE Sbjct: 559 PETLDGNNQYLCE 571
>USP9Y_HUMAN (O00507) Probable ubiquitin carboxyl-terminal hydrolase FAF-Y (EC| 3.1.2.15) (Ubiquitin thioesterase FAF-Y) (Ubiquitin-specific-processing protease FAF-Y) (Deubiquitinating enzyme FAF-Y) (Fat facets protein-related, Y-linked) (Ubiquitin-specif Length = 2555 Score = 36.6 bits (83), Expect = 0.017 Identities = 20/67 (29%), Positives = 31/67 (46%) Frame = +2 Query: 80 IVQDLFRGSVSHVTRCSSCGRDSDASSKMEDFYELELNIKGLSNLEESLDDYLSVEALNG 259 I+ + GS + C C + E F L ++I+ NL +SL+ Y+ + L G Sbjct: 1711 ILSKVLGGSFADQKICQGCPHRFECE---ESFTTLNVDIRNHQNLLDSLEQYIKGDLLEG 1767 Query: 260 ENQYSCE 280 N Y CE Sbjct: 1768 ANAYHCE 1774
>FAF_DROME (P55824) Probable ubiquitin carboxyl-terminal hydrolase FAF (EC| 3.1.2.15) (Ubiquitin thioesterase FAF) (Ubiquitin specific-processing protease FAF) (Deubiquitinating enzyme FAF) (Protein fat facets) Length = 2778 Score = 35.8 bits (81), Expect = 0.029 Identities = 21/60 (35%), Positives = 29/60 (48%) Frame = +2 Query: 101 GSVSHVTRCSSCGRDSDASSKMEDFYELELNIKGLSNLEESLDDYLSVEALNGENQYSCE 280 GS S C C SK E F ++I+ S+L ESL+ Y+ E L G + Y C+ Sbjct: 1831 GSFSDQKICQECPH---RYSKEEPFSVFSVDIRNHSSLTESLEQYVKGELLEGADAYHCD 1887
>UBP11_YEAST (P36026) Ubiquitin carboxyl-terminal hydrolase 11 (EC 3.1.2.15)| (Ubiquitin thioesterase 11) (Ubiquitin-specific-processing protease 11) (Deubiquitinating enzyme 11) Length = 717 Score = 35.8 bits (81), Expect = 0.029 Identities = 21/76 (27%), Positives = 36/76 (47%), Gaps = 11/76 (14%) Frame = +2 Query: 83 VQDLFRGSVSHVTRCSSCGRDSDASSKMEDFYELELNIKGLS-----------NLEESLD 229 + ++RG + ++ +C CG S + S FY L L I LS LE+ ++ Sbjct: 448 IDHIYRGQLENILKCQRCGNSSYSYS---TFYVLSLAIPKLSLYSFTSKSRKIKLEDCIN 504 Query: 230 DYLSVEALNGENQYSC 277 + E L+G+N + C Sbjct: 505 LFTGDEELSGDNAWDC 520
>UBP1_HUMAN (O94782) Ubiquitin carboxyl-terminal hydrolase 1 (EC 3.1.2.15)| (Ubiquitin thioesterase 1) (Ubiquitin-specific processing protease 1) (Deubiquitinating enzyme 1) (hUBP) Length = 785 Score = 35.4 bits (80), Expect = 0.038 Identities = 24/86 (27%), Positives = 41/86 (47%), Gaps = 19/86 (22%) Frame = +2 Query: 80 IVQDLFRGSVSHVTRCSSCGRDSDASSKMEDFYELELNIKG--LSNLEES---------- 223 +V+ LF+G + TRC C + + EDF ++ + ++ LS +EES Sbjct: 425 LVEKLFQGQLVLRTRCLEC---ESLTERREDFQDISVPVQEDELSKVEESSEISPEPKTE 481 Query: 224 -------LDDYLSVEALNGENQYSCE 280 + + SVE + GE++Y CE Sbjct: 482 MKTLRWAISQFASVERIVGEDKYFCE 507
>USP9X_MOUSE (P70398) Probable ubiquitin carboxyl-terminal hydrolase FAF-X (EC| 3.1.2.15) (Ubiquitin thioesterase FAF-X) (Ubiquitin-specific-processing protease FAF-X) (Deubiquitinating enzyme FAF-X) (Fat facets protein-related, X-linked) (Ubiquitin-specif Length = 2559 Score = 35.0 bits (79), Expect = 0.050 Identities = 19/60 (31%), Positives = 28/60 (46%) Frame = +2 Query: 101 GSVSHVTRCSSCGRDSDASSKMEDFYELELNIKGLSNLEESLDDYLSVEALNGENQYSCE 280 GS + C C + E F L ++I+ NL +SL+ Y+ + L G N Y CE Sbjct: 1716 GSFADQKICQGCPHRYECE---ESFTTLNVDIRNHQNLLDSLEQYVKGDLLEGANAYHCE 1772
>USP9X_HUMAN (Q93008) Probable ubiquitin carboxyl-terminal hydrolase FAF-X (EC| 3.1.2.15) (Ubiquitin thioesterase FAF-X) (Ubiquitin specific-processing protease FAF-X) (Deubiquitinating enzyme FAF-X) (Fat facets protein related, X-linked) (Ubiquitin-specif Length = 2547 Score = 35.0 bits (79), Expect = 0.050 Identities = 19/60 (31%), Positives = 28/60 (46%) Frame = +2 Query: 101 GSVSHVTRCSSCGRDSDASSKMEDFYELELNIKGLSNLEESLDDYLSVEALNGENQYSCE 280 GS + C C + E F L ++I+ NL +SL+ Y+ + L G N Y CE Sbjct: 1709 GSFADQKICQGCPHRYECE---ESFTTLNVDIRNHQNLLDSLEQYVKGDLLEGANAYHCE 1765
>UBP20_HUMAN (Q9Y2K6) Ubiquitin carboxyl-terminal hydrolase 20 (EC 3.1.2.15)| (Ubiquitin thioesterase 20) (Ubiquitin-specific-processing protease 20) (Deubiquitinating enzyme 20) Length = 913 Score = 33.1 bits (74), Expect = 0.19 Identities = 15/47 (31%), Positives = 28/47 (59%) Frame = +2 Query: 74 KTIVQDLFRGSVSHVTRCSSCGRDSDASSKMEDFYELELNIKGLSNL 214 ++++ D+F GS+ + +C +C R S+ +E F +L L I G +L Sbjct: 441 RSVISDIFDGSILSLVQCLTCDR---VSTTVETFQDLSLPIPGKEDL 484
>UBP7_YEAST (P40453) Ubiquitin carboxyl-terminal hydrolase 7 (EC 3.1.2.15)| (Ubiquitin thioesterase 7) (Ubiquitin-specific-processing protease 7) (Deubiquitinating enzyme 7) Length = 1071 Score = 32.7 bits (73), Expect = 0.25 Identities = 21/79 (26%), Positives = 34/79 (43%), Gaps = 14/79 (17%) Frame = +2 Query: 83 VQDLFRGSVSHVTRCSSCGRDSDASSKMEDFYELELNIKGLS--------------NLEE 220 + D+F+G + + +C CG + FY L L I S LE+ Sbjct: 763 IDDIFQGQMENSLQCKRCGY---TTFNYSTFYVLSLAIPRRSMKLSKLGRSTEKRVKLED 819 Query: 221 SLDDYLSVEALNGENQYSC 277 ++ + S E L+GEN + C Sbjct: 820 CINMFTSDEVLSGENAWDC 838
>UBP4_SCHPO (O60139) Probable ubiquitin carboxyl-terminal hydrolase 4 (EC| 3.1.2.15) (Ubiquitin thioesterase 4) (Ubiquitin-specific processing protease 4) (Deubiquitinating enzyme 4) Length = 438 Score = 32.0 bits (71), Expect = 0.42 Identities = 22/71 (30%), Positives = 36/71 (50%), Gaps = 3/71 (4%) Frame = +2 Query: 74 KTIVQDLFRGSVSHVTRCSSCGRDSDASSKMEDFYELELNIKGLS---NLEESLDDYLSV 244 K+IV + F G + T+C +CGR S+ F L + I +S +L+E L + + Sbjct: 222 KSIVVNNFVGQLCSRTQCMTCGR---TSTTFAPFTSLAIPIDDVSHVVSLQECLLKFSAP 278 Query: 245 EALNGENQYSC 277 E L G + + C Sbjct: 279 ELLQGHDGWHC 289
>UBPW_MOUSE (Q61068) Ubiquitin carboxyl-terminal hydrolase DUB-1 (EC 3.1.2.15)| (Ubiquitin thioesterase DUB-1) (Ubiquitin-specific processing protease DUB-1) (Deubiquitinating enzyme 1) Length = 526 Score = 31.6 bits (70), Expect = 0.55 Identities = 18/65 (27%), Positives = 31/65 (47%) Frame = +2 Query: 83 VQDLFRGSVSHVTRCSSCGRDSDASSKMEDFYELELNIKGLSNLEESLDDYLSVEALNGE 262 + D+F G +C C SD + F ++ L+I +++++L D E L G+ Sbjct: 166 IHDIFGGWWRSQIKCLLCQGTSDTYDR---FLDIPLDISSAQSVKQALWDTEKSEELCGD 222 Query: 263 NQYSC 277 N Y C Sbjct: 223 NAYYC 227
>UBP21_MOUSE (Q9QZL6) Ubiquitin carboxyl-terminal hydrolase 21 (EC 3.1.2.15)| (Ubiquitin thioesterase 21) (Ubiquitin-specific processing protease 21) (Deubiquitinating enzyme 21) Length = 566 Score = 30.8 bits (68), Expect = 0.94 Identities = 24/72 (33%), Positives = 34/72 (47%), Gaps = 6/72 (8%) Frame = +2 Query: 83 VQDLFRGSVSHVTRCSSCGRDSDASSKMEDFYELELNI--KGLSNLEESLDDYLSV---- 244 + DLF G + +C +CG S+ E F +L L I KG + + SL D S+ Sbjct: 371 IVDLFVGQLKSCLKCQACGY---RSTTFEVFCDLSLPIPKKGFAGGKVSLRDCFSLFTKE 427 Query: 245 EALNGENQYSCE 280 E L EN C+ Sbjct: 428 EELESENAPVCD 439
>GIDB_MYCGE (P47620) Methyltransferase gidB (EC 2.1.-.-) (Glucose-inhibited| division protein B) Length = 192 Score = 30.0 bits (66), Expect = 1.6 Identities = 16/48 (33%), Positives = 26/48 (54%), Gaps = 1/48 (2%) Frame = +2 Query: 134 CGRDSDASSKMEDFYELELNIKGLS-NLEESLDDYLSVEALNGENQYS 274 C R K+ D LN KG+ ++++SLD Y+ E N +NQ++ Sbjct: 122 CSRGLSTIIKVNDLAFSLLNSKGIIFHIKQSLDQYIEFEKSNQKNQFN 169
>UBP38_MOUSE (Q8BW70) Ubiquitin carboxyl-terminal hydrolase 38 (EC 3.1.2.15)| (Ubiquitin thioesterase 38) (Ubiquitin-specific-processing protease 38) (Deubiquitinating enzyme 38) Length = 1042 Score = 30.0 bits (66), Expect = 1.6 Identities = 21/73 (28%), Positives = 35/73 (47%), Gaps = 2/73 (2%) Frame = +2 Query: 68 VAKTIVQDLFRGSVSHVTRCSSCGRDSDASSKMEDFYELELNIKGLS--NLEESLDDYLS 241 V ++V GS C+ + S+K+ ++ N G S ++ + L+ +L+ Sbjct: 668 VCDSVVNQRVLGSPPVEFHCAESSSVPEESAKILISKDVPQNPGGESTTSVTDLLNYFLA 727 Query: 242 VEALNGENQYSCE 280 E L GENQY CE Sbjct: 728 PEVLTGENQYYCE 740
>UBP33_HUMAN (Q8TEY7) Ubiquitin carboxyl-terminal hydrolase 33 (EC 3.1.2.15)| (Ubiquitin thioesterase 33) (Ubiquitin-specific-processing protease 33) (Deubiquitinating enzyme 33) (VHL-interacting deubiquitinating enzyme 1) Length = 942 Score = 30.0 bits (66), Expect = 1.6 Identities = 14/47 (29%), Positives = 26/47 (55%) Frame = +2 Query: 74 KTIVQDLFRGSVSHVTRCSSCGRDSDASSKMEDFYELELNIKGLSNL 214 ++++ D+F G++ +C +C R S +E F +L L I G +L Sbjct: 472 RSVISDIFDGTIISSVQCLTCDR---VSVTLETFQDLSLPIPGKEDL 515
>UBP2_CHICK (O57429) Ubiquitin carboxyl-terminal hydrolase 2 (EC 3.1.2.15)| (Ubiquitin thioesterase 2) (Ubiquitin-specific-processing protease 2) (Deubiquitinating enzyme 2) (41 kDa ubiquitin-specific protease) Length = 357 Score = 30.0 bits (66), Expect = 1.6 Identities = 21/69 (30%), Positives = 33/69 (47%), Gaps = 4/69 (5%) Frame = +2 Query: 83 VQDLFRGSVSHVTRCSSCGRDSDASSKMEDFYELELNIKGLSNLEESLDDYLSV----EA 250 V DLF G + CS CG S+ + F++L L I E +L D L + + Sbjct: 163 VSDLFVGQLKSSLTCSECGY---CSTAFDPFWDLSLPIPKKGYGEVTLMDCLRLFTKEDV 219 Query: 251 LNGENQYSC 277 L+G+ + +C Sbjct: 220 LDGDEKPTC 228
>UBP21_HUMAN (Q9UK80) Ubiquitin carboxyl-terminal hydrolase 21 (EC 3.1.2.15)| (Ubiquitin thioesterase 21) (Ubiquitin-specific-processing protease 21) (Deubiquitinating enzyme 21) (NEDD8-specific protease) Length = 565 Score = 29.6 bits (65), Expect = 2.1 Identities = 23/72 (31%), Positives = 33/72 (45%), Gaps = 6/72 (8%) Frame = +2 Query: 83 VQDLFRGSVSHVTRCSSCGRDSDASSKMEDFYELELNI--KGLSNLEESLDD----YLSV 244 + DLF G + +C +CG S+ E F +L L I KG + + SL D + Sbjct: 370 IVDLFVGQLKSCLKCQACGY---RSTTFEVFCDLSLPIPKKGFAGGKVSLRDCFNLFTKE 426 Query: 245 EALNGENQYSCE 280 E L EN C+ Sbjct: 427 EELESENAPVCD 438
>UBP3_HUMAN (Q9Y6I4) Ubiquitin carboxyl-terminal hydrolase 3 (EC 3.1.2.15)| (Ubiquitin thioesterase 3) (Ubiquitin-specific-processing protease 3) (Deubiquitinating enzyme 3) Length = 521 Score = 28.9 bits (63), Expect = 3.6 Identities = 20/83 (24%), Positives = 34/83 (40%), Gaps = 14/83 (16%) Frame = +2 Query: 71 AKTIVQDLFRGSVSHVTRCSSCGRDSDASSKMEDFYELELNIKG--------------LS 208 A T+V +F G + + C CG + S K + F +L L+I + Sbjct: 307 ASTVVTAIFGGILQNEVNCLICGTE---SRKFDPFLDLSLDIPSQFRSKRSKNQENGPVC 363 Query: 209 NLEESLDDYLSVEALNGENQYSC 277 +L + L + +E L+ Y C Sbjct: 364 SLRDCLRSFTDLEELDETELYMC 386
>UBP3_MOUSE (Q91W36) Ubiquitin carboxyl-terminal hydrolase 3 (EC 3.1.2.15)| (Ubiquitin thioesterase 3) (Ubiquitin-specific-processing protease 3) (Deubiquitinating enzyme 3) Length = 520 Score = 28.9 bits (63), Expect = 3.6 Identities = 20/83 (24%), Positives = 34/83 (40%), Gaps = 14/83 (16%) Frame = +2 Query: 71 AKTIVQDLFRGSVSHVTRCSSCGRDSDASSKMEDFYELELNIKG--------------LS 208 A T+V +F G + + C CG + S K + F +L L+I + Sbjct: 306 ASTVVTAIFGGILQNEVNCLICGTE---SRKFDPFLDLSLDIPSQFRSKRSKNQENGPVC 362 Query: 209 NLEESLDDYLSVEALNGENQYSC 277 +L + L + +E L+ Y C Sbjct: 363 SLRDCLRSFTDLEELDETELYMC 385
>ARLY_CAMJR (Q5HUM8) Argininosuccinate lyase (EC 4.3.2.1) (Arginosuccinase)| (ASAL) Length = 460 Score = 28.5 bits (62), Expect = 4.6 Identities = 18/54 (33%), Positives = 27/54 (50%) Frame = +2 Query: 68 VAKTIVQDLFRGSVSHVTRCSSCGRDSDASSKMEDFYELELNIKGLSNLEESLD 229 V KT+ + +GS++H T SCG K E EL+ IKGL + ++ Sbjct: 27 VDKTLFNEDIQGSIAHATMLESCG-----ILKKE---ELDAIIKGLEQVRSEIE 72
>ARLY_CAMJE (Q46104) Argininosuccinate lyase (EC 4.3.2.1) (Arginosuccinase)| (ASAL) Length = 460 Score = 28.5 bits (62), Expect = 4.6 Identities = 18/54 (33%), Positives = 27/54 (50%) Frame = +2 Query: 68 VAKTIVQDLFRGSVSHVTRCSSCGRDSDASSKMEDFYELELNIKGLSNLEESLD 229 V KT+ + +GS++H T SCG K E EL+ IKGL + ++ Sbjct: 27 VDKTLFNEDIQGSIAHATMLESCG-----ILKKE---ELDAIIKGLEQVRSEIE 72
>SYK_XYLFT (Q87EB3) Lysyl-tRNA synthetase (EC 6.1.1.6) (Lysine--tRNA ligase)| (LysRS) Length = 506 Score = 28.5 bits (62), Expect = 4.6 Identities = 18/58 (31%), Positives = 27/58 (46%) Frame = +2 Query: 59 KVAVAKTIVQDLFRGSVSHVTRCSSCGRDSDASSKMEDFYELELNIKGLSNLEESLDD 232 + V T++Q F H S R+SD S D +EL +N K ++N L+D Sbjct: 378 EATVEHTLIQPTF--ITDHPVEISPLARESDIESGYTDRFELFINGKEIANGFSELND 433
>UBP38_HUMAN (Q8NB14) Ubiquitin carboxyl-terminal hydrolase 38 (EC 3.1.2.15)| (Ubiquitin thioesterase 38) (Ubiquitin-specific-processing protease 38) (Deubiquitinating enzyme 38) (HP43.8KD) Length = 1042 Score = 28.1 bits (61), Expect = 6.1 Identities = 16/48 (33%), Positives = 25/48 (52%) Frame = +2 Query: 74 KTIVQDLFRGSVSHVTRCSSCGRDSDASSKMEDFYELELNIKGLSNLE 217 KT+++ +F G + RC +C S K+E F +L L S+LE Sbjct: 583 KTLIEKMFGGKLRTHIRCLNC---RSTSQKVEAFTDLSLAFCPSSSLE 627
>YJI3_YEAST (P47030) Hypothetical 68.8 kDa protein in EXO70-ARP4 intergenic| region Length = 604 Score = 28.1 bits (61), Expect = 6.1 Identities = 11/40 (27%), Positives = 19/40 (47%) Frame = -3 Query: 170 LPFLKMHQNPFHMMNTESHVTHSREINLAQ*FSQQRPWSN 51 LPF H + + N SH H+ + F++ +PW + Sbjct: 393 LPFPHHHHHHHQLHNPNSHHLHTHHHTSSHKFNEDKPWKS 432
>DSC1_HUMAN (Q08554) Desmocollin-1 precursor (Desmosomal glycoprotein 2/3)| (DG2/DG3) Length = 894 Score = 27.7 bits (60), Expect = 7.9 Identities = 11/22 (50%), Positives = 16/22 (72%) Frame = -2 Query: 159 EDASESLPHDEHRVTCDTLPRN 94 ED +++ P+ EHRVT T+P N Sbjct: 233 EDDNDNAPYFEHRVTIFTVPEN 254 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 35,036,223 Number of Sequences: 219361 Number of extensions: 582674 Number of successful extensions: 1564 Number of sequences better than 10.0: 42 Number of HSP's better than 10.0 without gapping: 1532 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1556 length of database: 80,573,946 effective HSP length: 68 effective length of database: 65,657,398 effective search space used: 1575777552 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)