| Clone Name | bastl47e07 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | Y255_MYCGE (P47497) Hypothetical protein MG255 | 29 | 3.1 | 2 | Y358_MYCPN (P75422) Hypothetical protein MG255 homolog (H91_orf534) | 28 | 4.1 |
|---|
>Y255_MYCGE (P47497) Hypothetical protein MG255| Length = 365 Score = 28.9 bits (63), Expect = 3.1 Identities = 14/46 (30%), Positives = 25/46 (54%) Frame = +1 Query: 196 LAFQKLAWCSITTWRSTGSTVGMPVVLVLVSQLGGPRSHKKAPAYI 333 L+F K W +TT + G+T+G PV + ++Q G + + +I Sbjct: 142 LSFIKQQWPILTTLVTVGTTLGTPVFSLTIAQQDGIKQNAGNDVFI 187
>Y358_MYCPN (P75422) Hypothetical protein MG255 homolog (H91_orf534)| Length = 534 Score = 28.5 bits (62), Expect = 4.1 Identities = 12/32 (37%), Positives = 20/32 (62%) Frame = +1 Query: 196 LAFQKLAWCSITTWRSTGSTVGMPVVLVLVSQ 291 L+F K W +TT + G+T+G P+ + +SQ Sbjct: 140 LSFIKEQWPILTTLVTVGTTLGTPIFSITISQ 171 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 44,011,323 Number of Sequences: 219361 Number of extensions: 722639 Number of successful extensions: 1464 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1448 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1464 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 1391514312 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)