| Clone Name | bastl47d09 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | K0143_HUMAN (Q14156) Protein KIAA0143 (Fragment) | 33 | 0.13 | 2 | HRJ97_HUMAN (Q86Y56) Heat repeats-containing protein FLJ20397 | 32 | 0.49 | 3 | VG53_BPML5 (Q05269) Gene 53 protein (Gp53) | 29 | 2.4 | 4 | CDC45_YEAST (Q08032) Cell division control protein 45 | 29 | 2.4 | 5 | GA2L1_HUMAN (Q99501) GAS2-like protein 1 (Growth arrest-specific... | 27 | 9.2 | 6 | HUS2_SCHPO (Q09811) ATP-dependent DNA helicase hus2/rqh1 (EC 3.6... | 27 | 9.2 |
|---|
>K0143_HUMAN (Q14156) Protein KIAA0143 (Fragment)| Length = 885 Score = 33.5 bits (75), Expect = 0.13 Identities = 15/32 (46%), Positives = 20/32 (62%) Frame = +3 Query: 261 MCVCCPALRPSSRRPVKRYKKLLAEIFPKTPE 356 +C CC ALRP RYK+L+ IFP+ P+ Sbjct: 69 VCCCCSALRP-------RYKRLVDNIFPEDPK 93
>HRJ97_HUMAN (Q86Y56) Heat repeats-containing protein FLJ20397| Length = 855 Score = 31.6 bits (70), Expect = 0.49 Identities = 18/45 (40%), Positives = 23/45 (51%) Frame = +2 Query: 197 VGAPASEDGFHGGEAVPVVREHVRLLPGAASELAPPRQAVQEAAR 331 V AP +G EAV + R RLLPG ++ P R+ EA R Sbjct: 10 VAAPHPAEGAETAEAVELSRALSRLLPGLEADSKPGRRRALEALR 54
>VG53_BPML5 (Q05269) Gene 53 protein (Gp53)| Length = 234 Score = 29.3 bits (64), Expect = 2.4 Identities = 17/38 (44%), Positives = 20/38 (52%), Gaps = 1/38 (2%) Frame = +2 Query: 176 WVWRLLGVGAPASEDGFHGGEAVPVVREHVR-LLPGAA 286 WVW L + + H GEAV VR VR +L GAA Sbjct: 34 WVWYLESPYIQKTLESLHRGEAVHYVRNQVRNILSGAA 71
>CDC45_YEAST (Q08032) Cell division control protein 45| Length = 650 Score = 29.3 bits (64), Expect = 2.4 Identities = 14/37 (37%), Positives = 22/37 (59%) Frame = -1 Query: 352 GVLGNISASSFLYRLTGRRELGRSAGQQTHMLSHDGN 242 G G+ISAS F+ LT E+G S + + +++D N Sbjct: 414 GYRGSISASEFVEALTALLEVGNSTDKDSVKINNDNN 450
>GA2L1_HUMAN (Q99501) GAS2-like protein 1 (Growth arrest-specific 2-like 1)| (GAS2-related protein on chromosome 22) (GAR22 protein) Length = 681 Score = 27.3 bits (59), Expect = 9.2 Identities = 17/47 (36%), Positives = 22/47 (46%), Gaps = 1/47 (2%) Frame = +2 Query: 176 WVWRLLGVGAPASEDGFHGGEAV-PVVREHVRLLPGAASELAPPRQA 313 W+ L G+G P DGF G A + +H + AA LA R A Sbjct: 36 WLNALYGLGLPGGGDGFLTGLATGTTLCQHANAVTEAARALAAARPA 82
>HUS2_SCHPO (Q09811) ATP-dependent DNA helicase hus2/rqh1 (EC 3.6.1.-)| Length = 1328 Score = 27.3 bits (59), Expect = 9.2 Identities = 14/43 (32%), Positives = 21/43 (48%) Frame = -1 Query: 358 PSGVLGNISASSFLYRLTGRRELGRSAGQQTHMLSHDGNSFAP 230 P G+ N + + L L R+ L R + H +SH G+ F P Sbjct: 623 PEGLASNGAITRVLKSLYERKLLARIVIDEAHCVSHWGHDFRP 665 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 47,623,027 Number of Sequences: 219361 Number of extensions: 752944 Number of successful extensions: 2375 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 2320 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2373 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 1402043640 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)