| Clone Name | bastl47b03 |
|---|---|
| Clone Library Name | barley_pub |
>UBP5_ARATH (O22207) Ubiquitin carboxyl-terminal hydrolase 5 (EC 3.1.2.15)| (Ubiquitin thioesterase 5) (Ubiquitin-specific-processing protease 5) (Deubiquitinating enzyme 5) (AtUBP5) Length = 924 Score = 48.1 bits (113), Expect = 9e-06 Identities = 22/49 (44%), Positives = 29/49 (59%) Frame = +3 Query: 180 SSASCLPCTAEEERAAVDALTRQADANVKDGDLRYLISQSWWTNWQSYV 326 SS+S + EEER + + A+AN K+GD YLI+Q WW W YV Sbjct: 8 SSSSSTDLSPEEERVFIRDIAIAAEANSKEGDTFYLITQRWWQEWIEYV 56
>UBP32_HUMAN (Q8NFA0) Ubiquitin carboxyl-terminal hydrolase 32 (EC 3.1.2.15)| (Ubiquitin thioesterase 32) (Ubiquitin-specific-processing protease 32) (Deubiquitinating enzyme 32) (NY-REN-60 antigen) Length = 1604 Score = 33.1 bits (74), Expect = 0.31 Identities = 15/44 (34%), Positives = 23/44 (52%), Gaps = 1/44 (2%) Frame = +3 Query: 198 PCTAEEERAAVDA-LTRQADANVKDGDLRYLISQSWWTNWQSYV 326 P T EEE + L R++ ++ G ++IS WW W+ YV Sbjct: 368 PATPEEEGQIIRGWLERESRYGLQAGHNWFIISMQWWQQWKEYV 411
>UBP15_MOUSE (Q8R5H1) Ubiquitin carboxyl-terminal hydrolase 15 (EC 3.1.2.15)| (Ubiquitin thioesterase 15) (Ubiquitin-specific-processing protease 15) (Deubiquitinating enzyme 15) Length = 981 Score = 32.0 bits (71), Expect = 0.70 Identities = 15/48 (31%), Positives = 25/48 (52%), Gaps = 6/48 (12%) Frame = +3 Query: 216 ERAAVDALTRQAD------ANVKDGDLRYLISQSWWTNWQSYVGLLSY 341 E A D T+++D +++ GD YL+ W+ W+ YVG S+ Sbjct: 3 EGGAADLDTQRSDIATLLKTSLRKGDTWYLVDSRWFKQWKKYVGFDSW 50
>UBP15_HUMAN (Q9Y4E8) Ubiquitin carboxyl-terminal hydrolase 15 (EC 3.1.2.15)| (Ubiquitin thioesterase 15) (Ubiquitin-specific-processing protease 15) (Deubiquitinating enzyme 15) (Unph-2) (Unph4) Length = 981 Score = 32.0 bits (71), Expect = 0.70 Identities = 15/48 (31%), Positives = 25/48 (52%), Gaps = 6/48 (12%) Frame = +3 Query: 216 ERAAVDALTRQAD------ANVKDGDLRYLISQSWWTNWQSYVGLLSY 341 E A D T+++D +++ GD YL+ W+ W+ YVG S+ Sbjct: 3 EGGAADLDTQRSDIATLLKTSLRKGDTWYLVDSRWFKQWKKYVGFDSW 50
>CATA_SALTY (P17750) Peroxidase/catalase HPI (EC 1.11.1.6)| (Catalase-peroxidase) (Hydroperoxidase I) Length = 726 Score = 29.3 bits (64), Expect = 4.5 Identities = 15/30 (50%), Positives = 19/30 (63%), Gaps = 3/30 (10%) Frame = +3 Query: 252 DANVKDGDLRYLI--SQSWW-TNWQSYVGL 332 D + GDL+ L+ SQ WW +W SYVGL Sbjct: 70 DYSALKGDLKALLTDSQPWWPADWGSYVGL 99
>CATA_SALTI (Q8Z303) Peroxidase/catalase HPI (EC 1.11.1.6)| (Catalase-peroxidase) (Hydroperoxidase I) Length = 726 Score = 29.3 bits (64), Expect = 4.5 Identities = 15/30 (50%), Positives = 19/30 (63%), Gaps = 3/30 (10%) Frame = +3 Query: 252 DANVKDGDLRYLI--SQSWW-TNWQSYVGL 332 D + GDL+ L+ SQ WW +W SYVGL Sbjct: 70 DYSALKGDLKALLTDSQPWWPADWGSYVGL 99
>SUM1_YEAST (P46676) Suppressor of mar1-1 protein (SUM1-1 protein)| Length = 1062 Score = 29.3 bits (64), Expect = 4.5 Identities = 11/24 (45%), Positives = 17/24 (70%) Frame = -1 Query: 165 H*VSSSPSNPISRPTEIESNRIET 94 H + SSPSNP+S+P + ++R T Sbjct: 374 HQIPSSPSNPVSQPAPVRTSRSAT 397
>CLPX_HUMAN (O76031) ATP-dependent Clp protease ATP-binding subunit ClpX-like,| mitochondrial precursor Length = 633 Score = 28.9 bits (63), Expect = 5.9 Identities = 18/35 (51%), Positives = 19/35 (54%) Frame = -3 Query: 118 DRVESDRNEPTYLGFGTSSVLFGRNGKRRSGAAEA 14 DR+ S R YLGFGT S L GK R AA A Sbjct: 427 DRIISRRKNEKYLGFGTPSNL----GKGRRAAAAA 457
>GLI3_MOUSE (Q61602) Zinc finger protein GLI3| Length = 1596 Score = 28.5 bits (62), Expect = 7.7 Identities = 18/41 (43%), Positives = 23/41 (56%), Gaps = 7/41 (17%) Frame = +3 Query: 198 PCTAE-EERAAVDALTRQADANVKDGDL------RYLISQS 299 PC E A++ALT ADAN+ D DL +YL SQ+ Sbjct: 1064 PCPPSITENVALEALTMDADANLNDEDLLPDDVVQYLNSQN 1104
>DNAK1_PROMA (Q7VC04) Chaperone protein dnaK1 (Heat shock protein 70-1) (Heat| shock 70 kDa protein 1) (HSP70-1) Length = 666 Score = 28.5 bits (62), Expect = 7.7 Identities = 20/67 (29%), Positives = 31/67 (46%), Gaps = 2/67 (2%) Frame = +3 Query: 108 STRSQLGVRLDWRGMTIPSAEGLLSSASCLPCTAEEERAAVDALTRQADANVKD--GDLR 281 +T S +GV R I +AEG ++ S + T E E RQ N K+ +L+ Sbjct: 11 TTNSVIGVLEAGRPFVIANAEGSRTTPSVIGYTKESELVVGQQARRQLVLNPKNTFSNLK 70 Query: 282 YLISQSW 302 + +SW Sbjct: 71 RYVGRSW 77 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 66,375,108 Number of Sequences: 219361 Number of extensions: 1305648 Number of successful extensions: 3368 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 3286 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3368 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2618960580 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)