| Clone Name | bastl47a01 |
|---|---|
| Clone Library Name | barley_pub |
>LOX21_HORVU (P93184) Lipoxygenase 2.1, chloroplast precursor (EC 1.13.11.12)| (LOX-100) (LOX2:Hv:1) Length = 936 Score = 30.8 bits (68), Expect = 1.0 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 142 MLTATKPLVGGAC 180 MLTATKPLVGGAC Sbjct: 1 MLTATKPLVGGAC 13
>METB_HERAU (P24601) Probable cystathionine gamma-synthase (EC 2.5.1.48) (CGS)| (O-succinylhomoserine (thiol)-lyase) (Fragment) Length = 319 Score = 28.1 bits (61), Expect = 6.5 Identities = 12/28 (42%), Positives = 18/28 (64%) Frame = -3 Query: 159 LGRRQHRGYATVLAIALRDGAEGCTALV 76 L R Q RG+ +++I L+ GAE A+V Sbjct: 287 LAREQMRGFGGMISILLKGGAEAANAMV 314
>ACSA2_PSEPK (Q88DW6) Acetyl-coenzyme A synthetase 2 (EC 6.2.1.1) (Acetate--CoA| ligase 2) (Acyl-activating enzyme 2) Length = 644 Score = 28.1 bits (61), Expect = 6.5 Identities = 12/35 (34%), Positives = 18/35 (51%) Frame = -2 Query: 109 TRWGGRLHRLGWFRPS*TVQPCPGRSGKEEVMEGS 5 T W + RL W +P +VQ C +GK +G+ Sbjct: 37 TFWAEQAKRLDWIKPWSSVQQCDLHTGKARWFDGA 71
>SC10A_RAT (Q62968) Sodium channel protein type 10 alpha subunit (Sodium| channel protein type X alpha subunit) (Voltage-gated sodium channel alpha subunit Nav1.8) (Peripheral nerve sodium channel 3) (Sensory neuron sodium channel) Length = 1956 Score = 27.7 bits (60), Expect = 8.5 Identities = 16/50 (32%), Positives = 20/50 (40%) Frame = +3 Query: 63 LGRNQPRRCNLPPHRVAQ*PTP*RTHDADGDQAASRGRVCRAVVXGPAED 212 LGR + LP + Q P P R H +G G + GPA D Sbjct: 538 LGRGAGQTGPLPRSPLPQSPNPGRRHGEEGQLGVPTGELTAGAPEGPALD 587
>SFR16_MOUSE (Q8CFC7) Splicing factor, arginine/serine-rich 16 (Suppressor of| white-apricot homolog 2) (Clk4-associating SR-related protein) Length = 653 Score = 27.7 bits (60), Expect = 8.5 Identities = 21/61 (34%), Positives = 24/61 (39%) Frame = -2 Query: 211 SSAGPXTTARHTRPRLAAWSPSASWVRYGVGYCATRWGGRLHRLGWFRPS*TVQPCPGRS 32 S G + RH R R +WS S S R Y +R GR H G R P R Sbjct: 383 SRRGYYRSGRHARSRSRSWSRSRSRSR---RYSRSRSRGRRHSDGGSRDGHRYSRSPARR 439 Query: 31 G 29 G Sbjct: 440 G 440 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 32,588,271 Number of Sequences: 219361 Number of extensions: 593120 Number of successful extensions: 1353 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1343 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1353 length of database: 80,573,946 effective HSP length: 47 effective length of database: 70,263,979 effective search space used: 1686335496 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)