| Clone Name | bastl46c07 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | Y8I5_ENCCU (Q8SU92) Hypothetical protein ECU10_1850 | 33 | 0.41 | 2 | Y304_ENCCU (Q8SW83) Hypothetical protein ECU03_0040 | 33 | 0.41 | 3 | KAISO_MOUSE (Q8BN78) Transcriptional regulator Kaiso (Zinc finge... | 30 | 3.5 | 4 | HELC1_HUMAN (Q8N3C0) Activating signal cointegrator 1 complex su... | 30 | 4.6 | 5 | TRME_PORGI (Q7MVZ2) tRNA modification GTPase trmE | 29 | 6.0 | 6 | GP53_BPSP1 (O48407) Putative gene 53 protein | 29 | 6.0 |
|---|
>Y8I5_ENCCU (Q8SU92) Hypothetical protein ECU10_1850| Length = 268 Score = 33.1 bits (74), Expect = 0.41 Identities = 21/67 (31%), Positives = 35/67 (52%), Gaps = 11/67 (16%) Frame = +3 Query: 144 RFLRLLQPIRMD----------QWSSHN-PQG*INSTVQ*TLVHFLVLGFFILAQVQLSV 290 RF+ LL P W SHN P+G +++T+ TL + L L F I++ + ++ Sbjct: 56 RFITLLLPFSYSAVQYAVLLHTNWKSHNKPEGILHTTLYYTL-NLLFLAFSIISILSITT 114 Query: 291 DPIQRWR 311 PI +W+ Sbjct: 115 LPINKWK 121
>Y304_ENCCU (Q8SW83) Hypothetical protein ECU03_0040| Length = 268 Score = 33.1 bits (74), Expect = 0.41 Identities = 16/44 (36%), Positives = 30/44 (68%), Gaps = 1/44 (2%) Frame = +3 Query: 183 WSSHN-PQG*INSTVQ*TLVHFLVLGFFILAQVQLSVDPIQRWR 311 W SHN P+G +++T+ TL + L+L F I++ + ++ PI +W+ Sbjct: 79 WKSHNKPEGILHTTLYYTL-NLLLLAFSIISILSITTLPINKWK 121
>KAISO_MOUSE (Q8BN78) Transcriptional regulator Kaiso (Zinc finger and BTB| domain-containing protein 33) Length = 671 Score = 30.0 bits (66), Expect = 3.5 Identities = 13/57 (22%), Positives = 28/57 (49%) Frame = +1 Query: 25 KSLELKSFIFLELLRPSLPEIKSGAEGFAIRGSLWPPIRPDSCASSSRSAWTNGVLI 195 KSL+++ + +L ++P +K A G+ + PP+ S ++S + + I Sbjct: 588 KSLQIRQYAYLSNKSSAMPVMKDDAVGYKVDAGKEPPVGTTSTPPQNKSTFWEDIFI 644
>HELC1_HUMAN (Q8N3C0) Activating signal cointegrator 1 complex subunit 3 (EC| 3.6.1.-) (ASC-1 complex subunit p200) (Trip4 complex subunit p200) (Helicase, ATP binding 1) Length = 2202 Score = 29.6 bits (65), Expect = 4.6 Identities = 9/25 (36%), Positives = 17/25 (68%) Frame = +3 Query: 399 ASMRSRPRISAHHLRAYPRWRPLLK 473 +S+ + P I HHL + +W+P++K Sbjct: 1959 SSLLTLPNIENHHLHLFKKWKPIMK 1983
>TRME_PORGI (Q7MVZ2) tRNA modification GTPase trmE| Length = 474 Score = 29.3 bits (64), Expect = 6.0 Identities = 17/47 (36%), Positives = 27/47 (57%), Gaps = 2/47 (4%) Frame = -3 Query: 200 RVMRTPLVHADRLEEAQESGRIGGHKL--PRIANPSAPDFISGREGR 66 R RT ++ ++ E E+ RIG + +++ P+ P FIS REGR Sbjct: 335 REERTLILLVNKSESLAEADRIGLSETLQTKLSTPTKPIFISAREGR 381
>GP53_BPSP1 (O48407) Putative gene 53 protein| Length = 221 Score = 29.3 bits (64), Expect = 6.0 Identities = 16/46 (34%), Positives = 24/46 (52%) Frame = -3 Query: 284 QLDLGKNEEAQDQEMNKSSLHSTVDLTLRVMRTPLVHADRLEEAQE 147 +L + N+E Q + + SL S + TL +P AD LEE +E Sbjct: 94 RLQILVNKEVQGSQSTQQSLSSVFESTLEKYNSPDDFADYLEETEE 139 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 71,257,682 Number of Sequences: 219361 Number of extensions: 1447721 Number of successful extensions: 4121 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 4003 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4119 length of database: 80,573,946 effective HSP length: 104 effective length of database: 57,760,402 effective search space used: 3465624120 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)