| Clone Name | bastl46c01 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | AFSK_STRCO (P54741) Serine/threonine protein kinase afsK (EC 2.7... | 29 | 3.0 | 2 | KLP1_CHLRE (P46870) Kinesin-like protein KLP1 | 28 | 4.0 |
|---|
>AFSK_STRCO (P54741) Serine/threonine protein kinase afsK (EC 2.7.11.1)| Length = 799 Score = 28.9 bits (63), Expect = 3.0 Identities = 16/47 (34%), Positives = 19/47 (40%), Gaps = 1/47 (2%) Frame = +3 Query: 9 PHLFXXXXXXXXXXXXXXXXXXXSVSDGRRTGAVIVRPAHTAAG-GH 146 PHLF + +GRR G V+PA TA G GH Sbjct: 267 PHLFGSGSDDSGTASAWLPERAVGLIEGRRNGRPAVKPATTAGGRGH 313
>KLP1_CHLRE (P46870) Kinesin-like protein KLP1| Length = 776 Score = 28.5 bits (62), Expect = 4.0 Identities = 12/21 (57%), Positives = 15/21 (71%) Frame = +3 Query: 93 RRTGAVIVRPAHTAAGGHPKA 155 +RTGA + RPA A GG+ KA Sbjct: 736 KRTGAAVSRPATVATGGNAKA 756 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.313 0.132 0.399 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 29,541,112 Number of Sequences: 219361 Number of extensions: 339157 Number of successful extensions: 1199 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1118 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1196 length of database: 80,573,946 effective HSP length: 112 effective length of database: 56,005,514 effective search space used: 1344132336 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits)