| Clone Name | bastl45c04 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | CCAR1_MOUSE (Q8CH18) Cell division cycle and apoptosis regulator... | 30 | 2.9 | 2 | CCAR1_HUMAN (Q8IX12) Cell division cycle and apoptosis regulator... | 29 | 3.7 |
|---|
>CCAR1_MOUSE (Q8CH18) Cell division cycle and apoptosis regulator protein 1| (Cell cycle and apoptosis regulatory protein 1) (CARP-1) Length = 1146 Score = 29.6 bits (65), Expect = 2.9 Identities = 13/37 (35%), Positives = 21/37 (56%) Frame = +3 Query: 6 ERERREGEKYWERSSTGRRAELSLPSHAQLSDPKAQE 116 ER++ +GE+ E G E++ P+H DPKA + Sbjct: 601 ERKKADGEQDEEEKDDGEVKEIATPTHWSKLDPKAMK 637
>CCAR1_HUMAN (Q8IX12) Cell division cycle and apoptosis regulator protein 1| (Cell cycle and apoptosis regulatory protein 1) (CARP-1) (Death inducer with SAP domain) Length = 1150 Score = 29.3 bits (64), Expect = 3.7 Identities = 13/37 (35%), Positives = 19/37 (51%) Frame = +3 Query: 6 ERERREGEKYWERSSTGRRAELSLPSHAQLSDPKAQE 116 ER+ +GE+ E G E+S P+H DPK + Sbjct: 604 ERKEADGEQDEEEKDDGEAKEISTPTHWSKLDPKTMK 640 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 26,771,342 Number of Sequences: 219361 Number of extensions: 253033 Number of successful extensions: 923 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 908 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 923 length of database: 80,573,946 effective HSP length: 100 effective length of database: 58,637,846 effective search space used: 2169600302 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)