| Clone Name | bastl45b08 |
|---|---|
| Clone Library Name | barley_pub |
>WOX9_ARATH (Q6X7J4) WUSCHEL-related homeobox 9| Length = 378 Score = 29.3 bits (64), Expect = 2.5 Identities = 13/35 (37%), Positives = 17/35 (48%) Frame = -3 Query: 323 KHPPPQNRPQGAQQPRTSDSXXXXXXXAESTRETK 219 KH PQ +PQ QP S S ++ST+ K Sbjct: 123 KHSLPQTQPQPQPQPSASSSSSSSSSSSKSTKPRK 157
>DNAJ1_AZOSE (Q5P3M1) Chaperone protein dnaJ 1| Length = 347 Score = 28.9 bits (63), Expect = 3.2 Identities = 11/24 (45%), Positives = 15/24 (62%) Frame = -3 Query: 353 PHSALPSQARKHPPPQNRPQGAQQ 282 PH A + AR PPP+ P+GA + Sbjct: 70 PHDAQAADARPEPPPEAPPRGADR 93
>U2AFM_MOUSE (Q62377) U2 small nuclear ribonucleoprotein auxiliary factor 35 kDa| subunit related-protein 2 (U2(RNU2) small nuclear RNA auxillary factor 1-like 2) Length = 462 Score = 28.5 bits (62), Expect = 4.2 Identities = 12/30 (40%), Positives = 16/30 (53%) Frame = -3 Query: 365 RRRRPHSALPSQARKHPPPQNRPQGAQQPR 276 RRR+ HS P + + PPQ Q QP+ Sbjct: 428 RRRKDHSPGPWEPEQEEPPQQESQSQPQPQ 457
>CAC1S_HUMAN (Q13698) Voltage-dependent L-type calcium channel alpha-1S subunit| (Voltage-gated calcium channel alpha subunit Cav1.1) (Calcium channel, L type, alpha-1 polypeptide, isoform 3, skeletal muscle) Length = 1873 Score = 28.5 bits (62), Expect = 4.2 Identities = 14/32 (43%), Positives = 16/32 (50%) Frame = +3 Query: 21 TRSTHARTLSPPCRPRSPHSKTLVTLRTKNLT 116 T +T R L PCR PHSK V + LT Sbjct: 1696 TPATRGRALGQPCRVLGPHSKPCVEMLKGLLT 1727
>CSP_PLABA (P23093) Circumsporozoite protein precursor (CS)| Length = 347 Score = 27.7 bits (60), Expect = 7.2 Identities = 11/26 (42%), Positives = 14/26 (53%) Frame = -3 Query: 353 PHSALPSQARKHPPPQNRPQGAQQPR 276 P+ P Q +P PQ RPQ QP+ Sbjct: 202 PNDPAPPQGNNNPQPQPRPQPQPQPQ 227
>CSP_PLABE (P06915) Circumsporozoite protein precursor (CS)| Length = 339 Score = 27.7 bits (60), Expect = 7.2 Identities = 11/26 (42%), Positives = 14/26 (53%) Frame = -3 Query: 353 PHSALPSQARKHPPPQNRPQGAQQPR 276 P+ P Q +P PQ RPQ QP+ Sbjct: 194 PNDPAPPQGNNNPQPQPRPQPQPQPQ 219
>PAK6_HUMAN (Q9NQU5) Serine/threonine-protein kinase PAK 6 (EC 2.7.11.1)| (p21-activated kinase 6) (PAK-6) (PAK-5) Length = 681 Score = 27.3 bits (59), Expect = 9.3 Identities = 10/28 (35%), Positives = 18/28 (64%) Frame = -3 Query: 347 SALPSQARKHPPPQNRPQGAQQPRTSDS 264 +A PS ++ PPPQ++P + +P D+ Sbjct: 271 TAPPSSSKPGPPPQSKPNSSFRPPQKDN 298
>SIX5_HUMAN (Q8N196) Homeobox protein SIX5 (DM locus-associated homeodomain| protein) Length = 739 Score = 27.3 bits (59), Expect = 9.3 Identities = 15/38 (39%), Positives = 18/38 (47%), Gaps = 3/38 (7%) Frame = -3 Query: 317 PPPQNRPQGAQQPRTS---DSXXXXXXXAESTRETKET 213 PPPQ PQGA + +TS D E+ E ET Sbjct: 368 PPPQPSPQGASETKTSLVLDPQTGEVRLEEAQSEAPET 405
>PRPC_HUMAN (P02810) Salivary acidic proline-rich phosphoprotein 1/2 precursor| (PRP-1/PRP-2) (Parotid proline-rich protein 1/2) (Pr1/Pr2) (Protein C) (Parotid acidic protein) (Pa) (Parotid isoelectric focusing variant protein) (PIF-S) (Parotid double-band Length = 166 Score = 27.3 bits (59), Expect = 9.3 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = -3 Query: 338 PSQARKHPPPQNRPQGAQQ 282 P Q PPPQ RPQG Q Sbjct: 95 PQQGGHPPPPQGRPQGPPQ 113 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 37,524,236 Number of Sequences: 219361 Number of extensions: 418367 Number of successful extensions: 1924 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 1631 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1903 length of database: 80,573,946 effective HSP length: 97 effective length of database: 59,295,929 effective search space used: 1423102296 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)